DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and Alpi

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001074551.1 Gene:Alpi MGIID:1924018 Length:554 Species:Mus musculus

Alignment Length:488 Identity:209/489 (43%)
Similarity:288/489 (59%) Gaps:37/489 (8%)


  Fly    45 EELDTRFWHDKAQSILADKLAGHKKLN--ENRAKNVILFLGDGMSVHTIAATRAFMGD------S 101
            ||.:..||:.||    |:.|...|||.  :..|||:|:||||||.|.|:.|||...|.      .
Mouse    25 EEENPAFWNKKA----AEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGP 85

  Fly   102 NKQVFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDCVTNSSSHVQ 166
            ...:..:.|||:.|||||.|:.:.||||.||||||.||||||.|||::|..:...|.|...:.|.
Mouse    86 ETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVF 150

  Fly   167 SIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSKCSPDVNTDIARQLVEWP 231
            |:...|::|||..|:|||.||.||||||.|||...|||..|.|:.:|... |...|||.||:.  
Mouse   151 SVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQ-DGCKDIATQLIS-- 212

  Fly   232 VGQELRVIMGGGRSYF-----RDQSQHDETGVSGLRTDGRDLISDWREIKKQQGAEGKYVWSLKG 291
             ..::.||:||||.:.     .|.....::..||.|.|.::|:..|  :.|.|||  :|||:...
Mouse   213 -NMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTW--LSKHQGA--RYVWNRSE 272

  Fly   292 LKET--DISKTDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEGYFLFVES 354
            |.:.  |.:.| :|:|||:.:.:.|..:|.    ...:|||::|||.|::|||:|.:|::||||.
Mouse   273 LIQASQDPAVT-HLMGLFEPTEMKYDANRN----PSVDPSLAEMTEVAVRMLSRNPQGFYLFVEG 332

  Fly   355 GRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRRQNILSL 419
            ||||..|||..|..||.:...|.:|:|.|.::|:|:||||::|:||||..:..||..|..:|..|
Mouse   333 GRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGL 397

  Fly   420 APNLADDELPFTILSYANGPGFDDTYSTKDG-RIDLSHADTTSAEFEFQATVPLSSETHGAEDVG 483
            ||..|.|:..:|.:.|.||||    |..|.| |.:::.|.:....::.||.|||||||||.|||.
Mouse   398 APLKALDDKSYTSILYGNGPG----YELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVA 458

  Fly   484 VFASGPFEHLFTGNYEQSAIPAMMAYAANIGPF 516
            :||.||..||..|..||:.|..:||:|..:.|:
Mouse   459 IFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPY 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 202/470 (43%)
ALP_like 75..511 CDD:304875 197/450 (44%)
AlpiNP_001074551.1 Alk_phosphatase 53..488 CDD:278666 197/452 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21910665
eggNOG 1 0.900 E1_COG1785
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 386 1.000 Inparanoid score I1998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T130886
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.