DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and alpi.1

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001014375.1 Gene:alpi.1 ZFINID:ZDB-GENE-050327-78 Length:532 Species:Danio rerio

Alignment Length:489 Identity:207/490 (42%)
Similarity:280/490 (57%) Gaps:33/490 (7%)


  Fly    42 ALDEELDTRFWHDKAQSILADKLAGHKKLNENRAKNVILFLGDGMSVHTIAATRAFMGDSNKQ-- 104
            |.:.|.|..:|:|:|:..|...|.  ..|..|||||:|||:||||.|.|::|.|...|....|  
Zfish    30 AAEWEKDPAYWNDQARRTLQTALT--LPLRVNRAKNIILFVGDGMGVSTVSAARILRGQMEGQSG 92

  Fly   105 ----VFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDCVTNSSSHV 165
                :..:.||||.|||||.|:::..|||:|||||..|||||..|:|::|:....:|.|...:.|
Zfish    93 EETILAMDTFPYLALSKTYCVDKQVADSASTATAYHCGVKANAKTVGLSAKAVAYECNTTFGNEV 157

  Fly   166 QSIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSK----CSPDVNTDIARQ 226
            .|:...|:..||..|:|||.||.|||||..|||...|.|..|.::.|..    |.     |||.|
Zfish   158 FSVLHRAKAQGKSVGIVTTTRVQHASPAAAYAHSVSRKWYSDADVPSEARRQGCK-----DIATQ 217

  Fly   227 LVEWPVGQELRVIMGGGRSYFRDQS----QHDETGVSGLRTDGRDLISDWREIKKQQGAEGKYVW 287
            ||   ...::.||:||||.|...:.    ::..:...|.|.|.::||:.|...:|  |...:|||
Zfish   218 LV---TNTDIDVILGGGRMYMTPKGTPDPEYSSSSHKGDRKDKKNLINVWLNARK--GRNAQYVW 277

  Fly   288 SLKGLKETDISKTDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEGYFLFV 352
            :.:.....|:..||.|:|||:...:.:...|.||.    :||:.||||.||::||||.:|:||||
Zfish   278 NKEQFNAVDVKTTDCLMGLFEPKDMRFEVFRNRTR----DPSIVDMTEKAIQILSKNPKGFFLFV 338

  Fly   353 ESGRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRRQNIL 417
            |.||||..||...|..||.:|..|..|::.|.::|.|.|||.|||:||||..:..|...|...|.
Zfish   339 EGGRIDHGHHDGVAKLALTETIMFDRAIQRASELTSESDTLTVVTADHSHVFTFGGKTPRGNPIF 403

  Fly   418 SLAPNLADDELPFTILSYANGPGFDDTYSTKDGRIDLSHADTTSAEFEFQATVPLSSETHGAEDV 482
            .|||..|:|:||:|.:.||||||:|....|   |.::|..|....|::.||.|||.|||||.|||
Zfish   404 GLAPKQAEDDLPYTSILYANGPGYDHVNGT---RGNVSVLDYYDEEYKQQAAVPLESETHGGEDV 465

  Fly   483 GVFASGPFEHLFTGNYEQSAIPAMMAYAANIGPF 516
            .::|.||..|||.|..||:.:...|||||.:.|:
Zfish   466 AIYAKGPMAHLFHGVKEQNYVAHAMAYAACLEPY 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 199/468 (43%)
ALP_like 75..511 CDD:304875 194/450 (43%)
alpi.1NP_001014375.1 PhoA 46..493 CDD:224699 198/466 (42%)
Alk_phosphatase 61..496 CDD:278666 195/452 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21896015
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.