DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and Alp1

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001262159.1 Gene:Alp1 FlyBaseID:FBgn0283479 Length:530 Species:Drosophila melanogaster

Alignment Length:530 Identity:241/531 (45%)
Similarity:329/531 (62%) Gaps:40/531 (8%)


  Fly     8 LCFFALLVIQARSDLADDQEHAQHPRLQSSRDFEALDEELDTRFWHDKAQSILADKLAGHKKLNE 72
            |.|||.|.:|.   .|...::...|  :.|.|.:::.|.....||...||..|.:||:  ...|:
  Fly     4 LRFFAALALQL---TACSSQYKYGP--EQSWDLDSISELKSKEFWFHDAQRTLYNKLS--TPPNQ 61

  Fly    73 NRAKNVILFLGDGMSVHTIAATRAF-------MGDSNKQVFFEKFPYLGLSKTYAVNERTPDSAN 130
            .||||||.||||||||.|:.|.|.|       :|:.|: :.||||.|:||||||.||::..|||.
  Fly    62 YRAKNVIFFLGDGMSVPTVTAGRIFDGQLRGVVGERNR-LEFEKFNYVGLSKTYCVNKQVADSAC 125

  Fly   131 TATAYLTGVKANYGTIGVNAQVQRGDCVTN--SSSHVQSIGQWAQEAGKWAGLVTTARVTHASPA 193
            ||:|||:|:||||.||||.|.|:..||..:  ..:.:.||..||.:..|.||||||.||||||||
  Fly   126 TASAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSSIAAWALKGSKSAGLVTTTRVTHASPA 190

  Fly   194 GVYAHVSERNWEHDGEIISSKCSPDVNTDIARQLVEWPVGQELRVIMGGGRSYFRDQSQHDETGV 258
            |||||.|.|::|.|.::.....:|....|||:||::..||:.|||:||||...|...:.:|..|.
  Fly   191 GVYAHTSNRDFESDYDVTKLGQNPGNCPDIAQQLIDGDVGKRLRVVMGGGTIKFLPNTTNDVFGN 255

  Fly   259 SGLRTDGRDLISDWREIKKQQGAEGKYVWSLKGLKETDISKTDYLLGLFDTSHLPYHGDRRRTHY 323
            .|.|.|.|:||.:|::.|.   ...:.|:|...|...|...||:|||||:.|||.||.|      
  Fly   256 KGQRLDNRNLIEEWQQTKP---GNARVVFSRTDLLNNDAQNTDFLLGLFNASHLAYHMD------ 311

  Fly   324 EDA--EPSLSDMTEAAIKMLSKNEEGYFLFVESGRIDMAHHATKAMKALEDTEEFAAAVELARKM 386
             |:  .|:|.:||.|||.:||::..|||||||.||||.|||.|||.|||::|.:|:.||..||::
  Fly   312 -DSIDTPTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHAHHETKAKKALDETVQFSDAVRKARQL 375

  Fly   387 TDEEDTLIVVTSDHSHTMSINGYPYRRQNILSLAPNLAD-DELPFTILSYANGPGFDDTYSTKDG 450
            |:..||||||::||.||::|:|||....:|:.|...|:: |:||:|.:||||||.::..|.:.||
  Fly   376 TNPWDTLIVVSADHGHTVTISGYPDVNNSIVGLNSELSNVDQLPYTSISYANGPAYERFYKSTDG 440

  Fly   451 ---RIDLSHADTTSAEFEFQATVPLSSETHGAEDVGVFA-------SGPFEHLFTGNYEQSAIPA 505
               |:||.:.|.:..:..:...||::.||||..||.|:|       .||:.|||||.||||.:|.
  Fly   441 VVERVDLRNLDFSKPDAIYPHGVPMTEETHGGGDVAVYAHVVEYLLQGPWSHLFTGVYEQSTLPH 505

  Fly   506 MMAYAANIGP 515
            :|.:|:.:||
  Fly   506 LMGFASCLGP 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 225/476 (47%)
ALP_like 75..511 CDD:304875 219/458 (48%)
Alp1NP_001262159.1 alkPPc 65..514 CDD:214515 218/460 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455444
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I1952
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.