DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and alpl

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_957301.2 Gene:alpl ZFINID:ZDB-GENE-040420-1 Length:561 Species:Danio rerio

Alignment Length:537 Identity:224/538 (42%)
Similarity:294/538 (55%) Gaps:73/538 (14%)


  Fly     1 MVKSCLILCFFALLVIQARSDLADDQEHAQHPRLQSSRDFEALDEELDTRFWHDKAQSILADKLA 65
            ::.|||:.               :.:...|.|..:...|           :|.|.||..|.|.|.
Zfish    41 LILSCLVW---------------EGKTKVQFPEQEKRPD-----------YWRDFAQRSLKDALK 79

  Fly    66 GHKKLNENRAKNVILFLGDGMSVHTIAATRAFMGD------SNKQVFFEKFPYLGLSKTYAVNER 124
             .::||:|.|||:||||||||.|.|:.|.|...|.      ...|:..:|||::.|||||..|.:
Zfish    80 -LQELNKNIAKNIILFLGDGMGVPTVTAARILKGQLSGQNGEETQLEMDKFPHVALSKTYNTNAQ 143

  Fly   125 TPDSANTATAYLTGVKANYGTIGVNAQVQRGDCVTNSSSHVQSIGQWAQEAGKWAGLVTTARVTH 189
            .||||.||||:|.|||||.||:||:|...|..|.|...:.|.||.:||::|||..|:|||.||.|
Zfish   144 VPDSAGTATAFLCGVKANEGTVGVSAAAVRSQCNTTQGNEVTSILKWAKDAGKSVGIVTTTRVNH 208

  Fly   190 ASPAGVYAHVSERNWEHD----GEIISSKCSPDVNTDIARQLVE-WPVGQELRVIMGGGR----- 244
            |:|:..|||..:|:|..|    .|.:.|.|.     ||||||.| .|   ::.|||||||     
Zfish   209 ATPSAAYAHCVDRDWYSDADMPNEALQSGCK-----DIARQLFENIP---DINVIMGGGRRSMYP 265

  Fly   245 ------SYFRDQSQHDETGVSGLRTDGRDLISDWREIKKQQGAEGKYVWSLKGLKETDISKTDYL 303
                  .|..|:.|      :|.|.|||:|:.:|.:..|::  .|.|||:.|.|...:.:..|||
Zfish   266 KNTPDVEYPGDKKQ------NGTRKDGRNLVGEWIDRVKEK--RGFYVWNKKDLLSLNPNNVDYL 322

  Fly   304 LGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEGYFLFVESGRIDMAHHATKAMK 368
            ||||:.:.|.|..:|.    .:.:|||::|.:.|||:|.|||.|:||.||.||||..||..||.:
Zfish   323 LGLFEPADLNYELERN----TENDPSLTEMVDVAIKILKKNERGFFLLVEGGRIDHGHHEGKAKQ 383

  Fly   369 ALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRRQNILSLAPNLAD-DELPFTI 432
            ||.:..|...|:..|..:|.|.|||.|||:||||..|..||..|..:|..|||.|:| |:.|||.
Zfish   384 ALHEAVEMDRAITRAGLLTSEYDTLTVVTADHSHVFSFGGYTPRGNSIFGLAPTLSDVDQKPFTA 448

  Fly   433 LSYANGPGFDDTYSTKDGRIDLSHADTTSAEFEFQATVPLSSETHGAEDVGVFASGPFEHLFTGN 497
            :.|.|||||.   .....|.::|..|.....::.|:.|||..||||.|||.:|:.||..||..|.
Zfish   449 ILYGNGPGFK---LVNGARENVSTVDYQQNNYQAQSAVPLRMETHGGEDVAIFSKGPMAHLLHGV 510

  Fly   498 YEQSAIPAMMAYAANIG 514
            .||..||.:|||||.||
Zfish   511 QEQHYIPHVMAYAACIG 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 212/477 (44%)
ALP_like 75..511 CDD:304875 205/459 (45%)
alplNP_957301.2 Alk_phosphatase 88..526 CDD:278666 206/461 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21948599
eggNOG 1 0.900 E1_COG1785
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I1952
OMA 1 1.010
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T128611
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.