DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and Alp9

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001286944.1 Gene:Alp9 FlyBaseID:FBgn0035620 Length:517 Species:Drosophila melanogaster

Alignment Length:495 Identity:238/496 (48%)
Similarity:329/496 (66%) Gaps:20/496 (4%)


  Fly    27 EHAQHPRLQSSRDFEALDEELDTRFWHDKAQSILADKLAGHKKLNENRAKNVILFLGDGMSVHTI 91
            |...||.|.:|.....:..|....|||..::.::.:||...:  |..:|||:||||||||.:.|:
  Fly    29 EERMHPHLPTSPRLRTISGEETQEFWHSASKKLIREKLEFVR--NTKKAKNIILFLGDGMGLATL 91

  Fly    92 AATRAFMGDSNKQVFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGD 156
            ||.|:::|....::.||:||:.||||||:|::..||||.|:|:||.|||||||||||||.|:|||
  Fly    92 AAARSYIGGEELKLSFEEFPFTGLSKTYSVDKIVPDSACTSTSYLCGVKANYGTIGVNAHVKRGD 156

  Fly   157 C--VTNSSSHVQSIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSKCS--P 217
            |  :.|.::||.|:|:||.:|||.||||||.|||||||:||||||::|.||::. ::...|.  .
  Fly   157 CAAMANETNHVFSLGKWAMDAGKAAGLVTTTRVTHASPSGVYAHVADREWENNA-VLEEACGELS 220

  Fly   218 DVNTDIARQLVEWPVGQELRVIMGGGRSYFRDQSQHDETGVSGLRTDGRDLISDWREIKKQQGAE 282
            |...|||.||:...||.:|:|::|||:..|.....:|:    |.|||||:|:.::..:    .|.
  Fly   221 DGLQDIAVQLIHGEVGSKLKVMLGGGKRSFYSPEHYDK----GRRTDGRNLVEEFEAL----DAG 277

  Fly   283 GKYVWSLKGLKETDISKTDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEG 347
            ..:|.:.|.|...:.::|..|||||..||:.||.: :....::.||:|.:||:.||::|...|:|
  Fly   278 NTFVKTQKKLLNVNATETGRLLGLFSKSHMHYHLE-QLADPDNNEPTLEEMTQKAIEVLETEEQG 341

  Fly   348 YFLFVESGRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYR 412
            ||||||.|:||::||.|.|..||::|.|.:.||:.||:||:.|:||||||||||||.|::||..|
  Fly   342 YFLFVEGGKIDISHHETMARIALDETAELSKAVKKAREMTNPEETLIVVTSDHSHTFSVSGYQPR 406

  Fly   413 RQNILSLAPNLADDELPFTILSYANGPGFDDTYSTK-DGRIDLSHADTTSAEFE--FQATVPLSS 474
            ..:|...|.....|..|:..||||||..|.|.|:|: ..|:|.:...|. .:|:  |.|.|||.|
  Fly   407 GSDIFGAAKANGKDGKPYLALSYANGKSFQDYYNTETHERVDPTSLPTI-GDFDQLFPAMVPLES 470

  Fly   475 ETHGAEDVGVFASGPFEHLFTGNYEQSAIPAMMAYAANIG 514
            ||||.||||||||||:.|||||.|||:.||.|||:||.:|
  Fly   471 ETHGGEDVGVFASGPWAHLFTGVYEQNTIPHMMAFAACVG 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 226/461 (49%)
ALP_like 75..511 CDD:304875 224/443 (51%)
Alp9NP_001286944.1 PRK10518 12..496 CDD:236706 229/480 (48%)
ALP_like 75..508 CDD:304875 225/444 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455417
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I1952
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.