DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and Alp11

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_573047.1 Gene:Alp11 FlyBaseID:FBgn0030661 Length:483 Species:Drosophila melanogaster

Alignment Length:507 Identity:209/508 (41%)
Similarity:273/508 (54%) Gaps:74/508 (15%)


  Fly    28 HAQHPRLQSS----RDFEALDEELDTRFWHDKAQSILADKLAGHKK--LNENRAKNVILFLGDGM 86
            ||..|.|..|    ...:..||.|.:. |..:|||.|.::||..|.  .:..:||||::.||||:
  Fly    15 HALIPILALSVPMVEQVQPADELLSSH-WLRQAQSQLRERLARTKDSIADVRQAKNVVMLLGDGL 78

  Fly    87 SVHTIAATRAFMGD------SNKQVFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGT 145
            |:.|:.|.|...|.      .:.|:..|:||:.||||||.::|:|||||.|||||..|||.:.||
  Fly    79 SITTLTAARILKGQRRGGRGEDAQLAVEQFPFSGLSKTYCIDEQTPDSACTATAYFGGVKTHSGT 143

  Fly   146 IGVNAQVQRGDCVTNSSSHVQSIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEI 210
            :|     |.|     |...|.|:.||||.|||..|:|||.|:|.|||||.|||||.|..|     
  Fly   144 VG-----QSG-----SGERVDSVLQWAQRAGKATGVVTTTRLTDASPAGAYAHVSRRGEE----- 193

  Fly   211 ISSKCSPDVNTDIARQLVEWPVGQELRVIMGGGRSYFRDQSQHDETGVSGLRTDGRDLISDWREI 275
                      .:|||||||...|:.|.||:|||...|.|:           |.||:||::.||| 
  Fly   194 ----------LEIARQLVEEEPGRNLNVILGGGLGKFADE-----------RRDGKDLLAQWRE- 236

  Fly   276 KKQQGAEGKYVWSLKGLKE-TDISKTDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIK 339
               ....|.:..|||.|:. ||.:.|  |||:|..||:.||     .......|.|.||..|||:
  Fly   237 ---SNPNGCFSRSLKELRNCTDATGT--LLGIFSDSHMSYH-----LAASKELPRLCDMAAAAIE 291

  Fly   340 MLSKNEE----GYFLFVESGRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDH 400
            .|.:..:    |||:|:|.||||..||.|:...||::..||.||||...:|||..|||:|||:||
  Fly   292 KLERKSQEDGNGYFVFIEGGRIDHGHHETRVGYALDEMVEFDAAVETVIQMTDPRDTLVVVTADH 356

  Fly   401 SHTMSINGYPYRRQNILSLAPNLAD-DELPFTILSYANG--PGFDDTYSTKDGRIDLSHADTTSA 462
            |||:|::||..|...||.:.....| :.:|::.|:||.|  ...|     ||||.: |.:.|.|.
  Fly   357 SHTLSMSGYAKRGTPILGMDAQQRDVNGVPYSTLNYAIGKWQSLD-----KDGRRE-SPSKTLSP 415

  Fly   463 EFEFQATVPLSSETHGAEDVGVFASGPFEHLFTGNYEQSAIPAMMAYAANIG 514
            .....:.:......|..|||.|||.||..|||.|..||:.:|.:|.|||.:|
  Fly   416 TSYTPSYIHGRKGVHSGEDVVVFAMGPQSHLFGGVMEQNLLPHIMGYAACLG 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 197/470 (42%)
ALP_like 75..511 CDD:304875 191/450 (42%)
Alp11NP_573047.1 ALP_like 68..467 CDD:304875 191/452 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455544
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.