DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and ALPI

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001622.2 Gene:ALPI HGNCID:437 Length:528 Species:Homo sapiens

Alignment Length:503 Identity:215/504 (43%)
Similarity:294/504 (58%) Gaps:44/504 (9%)


  Fly    33 RLQSSRDFEALDEELDTRFWHDKAQSILADKLAGHKKLN--ENRAKNVILFLGDGMSVHTIAATR 95
            |||.|......:|| :..||:.:|    |:.|...|||.  :..|||:|||||||:.|.|:.|||
Human    13 RLQLSLGVIPAEEE-NPAFWNRQA----AEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATR 72

  Fly    96 AFMGDSNKQ------VFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQR 154
            ...|..|.:      :..::||||.|||||.|:.:.||||.||||||.|||||:.|||::|..:.
Human    73 ILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARF 137

  Fly   155 GDCVTNSSSHVQSIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSK----C 215
            ..|.|...:.|.|:...|::|||..|:|||.||.||||||.|||...|||..|.::.:|.    |
Human   138 NQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGC 202

  Fly   216 SPDVNTDIARQLVEWPVGQELRVIMGGGRSYFRDQSQHD-----ETGVSGLRTDGRDLISDWREI 275
            .     |||.||:.   ..::.||:||||.|.......|     :...:|:|.||::|:.:|  :
Human   203 Q-----DIATQLIS---NMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEW--L 257

  Fly   276 KKQQGAEGKYVWSLKGLKETDISKT-DYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIK 339
            .|.|||  .|||:...|.:..:.:: .:|:|||:.....|...|..|    .:|||.:|||||::
Human   258 AKHQGA--WYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPT----LDPSLMEMTEAALR 316

  Fly   340 MLSKNEEGYFLFVESGRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTM 404
            :||:|..|::||||.||||..||...|.:||.:...|..|:|.|.::|.|||||.:||:||||..
Human   317 LLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVF 381

  Fly   405 SINGYPYRRQNILSLAPNLADDELPFTILSYANGPGFDDTYSTKDG-RIDLSHADTTSAEFEFQA 468
            |..||..|..:|..|||:.|.|...:|.:.|.||||    |....| |.|::.:::.|.:::.||
Human   382 SFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPG----YVFNSGVRPDVNESESGSPDYQQQA 442

  Fly   469 TVPLSSETHGAEDVGVFASGPFEHLFTGNYEQSAIPAMMAYAANIGPF 516
            .|||||||||.|||.|||.||..||..|..|||.:..:||:||.:.|:
Human   443 AVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 204/473 (43%)
ALP_like 75..511 CDD:304875 199/453 (44%)
ALPINP_001622.2 Alk_phosphatase 52..487 CDD:306706 200/455 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21922240
eggNOG 1 0.900 E1_COG1785
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 382 1.000 Inparanoid score I2031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T130110
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.