DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and Akp3

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_031458.2 Gene:Akp3 MGIID:87984 Length:559 Species:Mus musculus

Alignment Length:503 Identity:214/504 (42%)
Similarity:292/504 (58%) Gaps:45/504 (9%)


  Fly    33 RLQSSRDFEALDEELDTRFWHDKAQSILADKLAGHKKLN--ENRAKNVILFLGDGMSVHTIAATR 95
            |||.|.....::|| :..||:.||    |:.|...|||.  :..|||:|:||||||.|.|:.|||
Mouse    13 RLQLSLSVIPVEEE-NPAFWNKKA----AEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATR 72

  Fly    96 AFMGD------SNKQVFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQR 154
            ...|.      ....:..::|||:.|||||:|:.:.||||:||||||.|||.||.||||:|..:.
Mouse    73 ILKGQLEGHLGPETPLAMDRFPYMALSKTYSVDRQVPDSASTATAYLCGVKTNYKTIGVSAAARF 137

  Fly   155 GDCVTNSSSHVQSIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSK----C 215
            ..|.|...:.|.|:...|::|||..|:|||.||.||||:|.|.|...|||..|.::.:|.    |
Mouse   138 DQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPSGTYVHTVNRNWYGDADMPASALREGC 202

  Fly   216 SPDVNTDIARQLVEWPVGQELRVIMGGGRSYF-----RDQSQHDETGVSGLRTDGRDLISDWREI 275
            .     |||.||:.   ..::.||:||||.|.     .|....::...:|.|.|||:|:.:|  :
Mouse   203 K-----DIATQLIS---NMDINVILGGGRKYMFPAGTPDPEYPNDANETGTRLDGRNLVQEW--L 257

  Fly   276 KKQQGAEGKYVWSLKGL--KETDISKTDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAI 338
            .|.||::  |||:.:.|  |..|.|.| ||:|||:.....:  |.:|....|  |||.||||||:
Mouse   258 SKHQGSQ--YVWNREQLIQKAQDPSVT-YLMGLFEPVDTKF--DIQRDPLMD--PSLKDMTEAAV 315

  Fly   339 KMLSKNEEGYFLFVESGRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHT 403
            |:||:|.:|::||||.||||..||...|..||.:...|..|:|.|.::|.|.|||.:||:||||.
Mouse   316 KVLSRNPKGFYLFVEGGRIDRGHHLGTAYLALTEAVMFDLAIERASQLTSERDTLTIVTADHSHV 380

  Fly   404 MSINGYPYRRQNILSLAPNLADDELPFTILSYANGPGFDDTYSTKDGRIDLSHADTTSAEFEFQA 468
            .|..||..|..:|..|||..|.|..|:|.:.|.||||:..|    ..|.:::.|:::.:.:..||
Mouse   381 FSFGGYTLRGTSIFGLAPLNALDGKPYTSILYGNGPGYVGT----GERPNVTAAESSGSSYRQQA 441

  Fly   469 TVPLSSETHGAEDVGVFASGPFEHLFTGNYEQSAIPAMMAYAANIGPF 516
            .||:.|||||.|||.:||.||..||..|..||:.|..:||:|..:.|:
Mouse   442 AVPVKSETHGGEDVAIFARGPQAHLLHGVQEQNYIAHVMAFAGCLEPY 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 203/473 (43%)
ALP_like 75..511 CDD:304875 198/453 (44%)
Akp3NP_031458.2 Alk_phosphatase 52..486 CDD:278666 198/455 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21903536
eggNOG 1 0.900 E1_COG1785
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 386 1.000 Inparanoid score I1998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T130886
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.