DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and alpi.2

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001116946.1 Gene:alpi.2 XenbaseID:XB-GENE-854953 Length:532 Species:Xenopus tropicalis

Alignment Length:494 Identity:217/495 (44%)
Similarity:293/495 (59%) Gaps:40/495 (8%)


  Fly    42 ALDEELDTRFWHDKAQSILADKLAGHKKLN--ENRAKNVILFLGDGMSVHTIAATRAFMGDSNKQ 104
            :|:.|.:.:||:|:|:..|.:.|    .||  .:||||:|:||||||.|.||||.|.:.|....|
 Frog    35 SLEAEKNPKFWNDQAKETLKNAL----NLNPITHRAKNLIMFLGDGMGVTTIAAARIYQGQVEGQ 95

  Fly   105 ------VFFEKFPYLGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDCVTNSSS 163
                  :..|||||:.|||.|.|:.:.||||.|.||||.|||||.||:||:|....|:||::..:
 Frog    96 PGEENIMAMEKFPYVALSKVYNVDAQVPDSAGTGTAYLCGVKANSGTLGVSAAAIYGNCVSSKGN 160

  Fly   164 HVQSIGQWAQEAGKWAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSKCSPDVNT---DIAR 225
            .|.||...|:.|||..|:|||.||.||||...|||.:.|||..|.|:.|:.    :|.   |||.
 Frog   161 EVTSILHRAKLAGKSVGIVTTTRVQHASPGAAYAHSASRNWYSDNEMTSAM----INNGCKDIAY 221

  Fly   226 QLVEWPVGQELRVIMGGGRSYF-----RDQSQHDETGVSGLRTDGRDLISDWREIKKQQGAEGKY 285
            |||.   ..::.||:||||:|.     .|......:...|||.||.:|...|  :.|:|.|  :|
 Frog   222 QLVH---NTDIDVILGGGRAYMYPAGTPDPEYPGSSADRGLRRDGLNLTDIW--LSKRQNA--RY 279

  Fly   286 VWSLKGLKETDISKTDYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEGYFL 350
            ||:.:.....::..||||:|||:...:.|..:|..:    .:|||::|||.||::||||.:|:||
 Frog   280 VWNKEQFNAVNVDTTDYLMGLFEPKDMKYELNRNAS----LDPSLAEMTEKAIRILSKNPKGFFL 340

  Fly   351 FVESGRIDMAHHATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRRQN 415
            |||.||||..||...|.::|.:..||..||....::|.|.:||.|||:||||..:..||..|..:
 Frog   341 FVEGGRIDHGHHDGNAKQSLTEALEFDKAVLRGGQLTQENETLTVVTADHSHVFTFGGYTDRGNS 405

  Fly   416 ILSLAPNLADDELPFTILSYANGPGFDDTYSTKDG-RIDLSHADTTSAEFEFQATVPLSSETHGA 479
            |..|||:||.|..|:|.|.|.||||    |...|. |.:::..:|.|..:..||.||:.|||||.
 Frog   406 IFGLAPSLASDRKPYTSLLYGNGPG----YPLPDAIRANITGVNTGSNSYLQQAAVPVVSETHGG 466

  Fly   480 EDVGVFASGPFEHLFTGNYEQSAIPAMMAYAANIGPFAK 518
            |||.:.|.||..|||.|.:|||.|..:|||||.:.|:.:
 Frog   467 EDVAIMAKGPQAHLFHGFHEQSYIAHVMAYAACLEPYTE 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 209/471 (44%)
ALP_like 75..511 CDD:304875 204/451 (45%)
alpi.2NP_001116946.1 Alk_phosphatase 66..500 CDD:278666 205/453 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.