DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP71B11

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_197894.1 Gene:CYP71B11 AraportID:AT5G25120 Length:496 Species:Arabidopsis thaliana

Alignment Length:546 Identity:115/547 (21%)
Similarity:205/547 (37%) Gaps:131/547 (24%)


  Fly     4 ALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLH 68
            :|.|.|:|.:.    .|.|.|:...:       |||.:.            .|||...|||||||
plant     2 SLWYIIVAFVF----FSTIIIVRNTR-------KTKKNL------------PPGPPRLPIIGNLH 43

  Fly    69 LLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRP-------- 125
            .|.   ..|.:....|:::||.:.:|.||....:|.:..|.::|||.........||        
plant    44 QLG---SKPHSSMFKLSEKYGPLMALRFGSVSTVVASTPETVKEVLKTFDAECCSRPYMTYPARL 105

  Fly   126 -------DFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEME 183
                   .|..|.|.:...|..::.     :|...:|..:.:|....|.:.....::|....|  
plant   106 TYNLKDIGFCPYTKYWREVRKMTVV-----ELYTAKRVQSFQHTRKEEVASLVDFITQAASLE-- 163

  Fly   184 HWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVD--FQQIVQYFDEIFWEINQG 246
                         :|:|:...::|...::..:.:..:......::  :::::|...|:   :...
plant   164 -------------KPVNLNTKLMKLSGSVICRVVFGINLKGSKLENLYEEVIQGTMEV---VGSF 212

  Fly   247 HPLDFLPWLYPFYQRHLNKIINWSS-------TIRGFIMERIIRHRELSVDLDEPDR-DFTDALL 303
            ...|:    :|...|.:::|....|       .:..|..:.|..|.|     ||..: |..|.||
plant   213 AAADY----FPIIGRIIDRITGLHSKCEKIFKAMDAFFDQSIKHHLE-----DESIKDDIIDLLL 268

  Fly   304 K------SLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEI------ 356
            |      .|.|.:....||...:......|......::..|:.|:..|..:.::.|.|:      
plant   269 KMERGEIELGEFQLTRDNTKGILFNILNAGIDTSAQVMTWVMTYLISNPRVMKKAQAEVREVIKN 333

  Fly   357 -DAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPIV----PHVATEDTVISGYGVTKGTIVF 416
             |.||||:...:..|.|     .:...|.||     |:|    |..|::|..|.||.:.|.|.:.
plant   334 KDDIIEEDIERLEYLKM-----VVKETFRVL-----PLVPLLIPREASKDVKIGGYDIPKKTWIH 388

  Fly   417 INNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIG 481
            :|.:.::.:...|.:|:.|.|.||::...:....|.:                     ||||..|
plant   389 VNIWAIHRNPNVWKDPEAFIPERFMDNQIDYKGLNFE---------------------FLPFGSG 432

  Fly   482 KRTCIGQNLVRGFGFLVVVNVMQRYN 507
            :|.|.|..:......|.::|::.|::
plant   433 RRMCPGIGMGMALVHLTLINLLYRFD 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 105/495 (21%)
CYP71B11NP_197894.1 p450 1..490 CDD:299894 115/547 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.920

Return to query results.
Submit another query.