DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP81D8

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_195453.1 Gene:CYP81D8 AraportID:AT4G37370 Length:497 Species:Arabidopsis thaliana

Alignment Length:569 Identity:125/570 (22%)
Similarity:223/570 (39%) Gaps:191/570 (34%)


  Fly     5 LIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPW--PIIGNL 67
            ||::||.::||:     |.:|..:||:...|                    |.| .|  |:||:|
plant     6 LIFSILFVVLSL-----IYLIGKLKRKPNLP--------------------PSP-AWSLPVIGHL 44

  Fly    68 HLLDRYRDSPFAGFTALAQQYGD--IYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRY 130
            .||   :......|.:|:|...:  |:||..|:....|.::..:..|...:|..|::.||:||  
plant    45 RLL---KPPIHRTFLSLSQSLNNAPIFSLRLGNRLVFVNSSHSIAEECFTKNDVVLANRPNFI-- 104

  Fly   131 HKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWN--RELGN-Q 192
                                      || :|.:       |...:.|.....:||.  |.:|: :
plant   105 --------------------------LA-KHVA-------YDYTTMIAASYGDHWRNLRRIGSVE 135

  Fly   193 LVPGEPIN---------IKPLILKACANMFSQ---------YMCSLRFD---------------- 223
            :.....:|         |:.|:.:...| |||         .:..|.|:                
plant   136 IFSNHRLNSFLSIRKDEIRRLVFRLSRN-FSQEFVKVDMKSMLSDLTFNNILRMVAGKRYYGDGV 199

  Fly   224 YDDVDFQQIVQYFDEIFWEINQGHPLDFLP--WLYPFYQRHLNKII-NWSSTIRGFIMER----- 280
            .||.:.:::.|...::......|:.:|:||  .|...|:..:.|:. .....::|.:.|:     
plant   200 EDDPEAKRVRQLIADVVACAGAGNAVDYLPVLRLVSDYETRVKKLAGRLDEFLQGLVDEKREAKE 264

  Fly   281 ----IIRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLA- 340
                :|.|. |::...:||. |||.::|                           ||::.|:|| 
plant   265 KGNTMIDHL-LTLQESQPDY-FTDRIIK---------------------------GNMLALILAG 300

  Fly   341 ---------YIAKNV----DIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSS 391
                     :...||    |:..:.::|||..|..: |.::..|::.:||....:.|.|| |.::
plant   301 TDTSAVTLEWALSNVLNHPDVLNKARDEIDRKIGLD-RLMDESDISNLPYLQNIVSETLRLYPAA 364

  Fly   392 P-IVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGS 455
            | ::||||:||..::||.:.:|||:..|.:.::...:.|.:|..|.|.||               
plant   365 PMLLPHVASEDCKVAGYDMPRGTILLTNVWAIHRDPQLWDDPMSFKPERF--------------- 414

  Fly   456 DSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQ 504
                |.:.|..:|       :||.:|:|.|.|..|......|.:.:::|
plant   415 ----EKEGEAQKL-------MPFGLGRRACPGSGLAHRLINLTLGSLIQ 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 114/519 (22%)
CYP81D8NP_195453.1 p450 5..487 CDD:299894 125/570 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.