DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and FAH1

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_195345.1 Gene:FAH1 AraportID:AT4G36220 Length:520 Species:Arabidopsis thaliana

Alignment Length:523 Identity:131/524 (25%)
Similarity:217/524 (41%) Gaps:116/524 (22%)


  Fly     8 TILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDR 72
            |.|.|::|:    :|.|.:..:||                   :....||||.||||||:.::|:
plant    17 TSLVIVVSL----FIFISFITRRR-------------------RPPYPPGPRGWPIIGNMLMMDQ 58

  Fly    73 YRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGE 137
            .   ...|...||::||.:..|..|......|::.|:.|:||.....|.|.||..|..       
plant    59 L---THRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAI------- 113

  Fly   138 RSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGC-------EEMEHWN--RELGNQL 193
                      |.|...|.::|..|..|     |:.:|.:: |       :..|.|.  |:..:::
plant   114 ----------SYLTYDRADMAFAHYGP-----FWRQMRKV-CVMKVFSRKRAESWASVRDEVDKM 162

  Fly   194 V------PGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFL 252
            |      .|:|||:...|.....|:..:.......:....:|.:|:|.|.::|...|..   ||:
plant   163 VRSVSCNVGKPINVGEQIFALTRNITYRAAFGSACEKGQDEFIRILQEFSKLFGAFNVA---DFI 224

  Fly   253 P---WLYPFYQRHLNK-IINWSSTIRGFIMERIIRHRELSV------DLDEPDRDFTDALL---- 303
            |   |:.|   :.:|| ::...:.:.|||.:.|..|.:...      |.|..|.|..|.||    
plant   225 PYFGWIDP---QGINKRLVKARNDLDGFIDDIIDEHMKKKENQNAVDDGDVVDTDMVDDLLAFYS 286

  Fly   304 ---KSLLEDKD------VSRNTIIFMLED-FIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDA 358
               |.:.|..|      ::|:.|..::.| ..||...|.:.:...|..:.::.:..:|:|:|:..
plant   287 EEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAE 351

  Fly   359 IIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSPIVPHVATEDTVISGYGVTKGTIVFINNYVL 422
            ::..:.| :...|:..:.|...|:.|.|| :...|::.|...|||.|.|:.:.|.:.|.||.:.:
plant   352 VVGLDRR-VEESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTSIDGFFIPKKSRVMINAFAI 415

  Fly   423 NTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIG 487
            ......|.:|..|.|.|||||    ...:.|||:.                .|:||..|:|:|.|
plant   416 GRDPTSWTDPDTFRPSRFLEP----GVPDFKGSNF----------------EFIPFGSGRRSCPG 460

  Fly   488 QNL 490
            ..|
plant   461 MQL 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 123/476 (26%)
FAH1NP_195345.1 PLN02183 1..520 CDD:165828 131/524 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.