DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP705A3

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_193271.5 Gene:CYP705A3 AraportID:AT4G15360 Length:527 Species:Arabidopsis thaliana

Alignment Length:499 Identity:118/500 (24%)
Similarity:203/500 (41%) Gaps:74/500 (15%)


  Fly     9 ILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRY 73
            ||..|.|:|..|            |...|.|:|        :.:.....|...||||:||||  .
plant    15 ILLCLFSLLCHS------------LFFKKPKDS--------RSFVLPSSPPSLPIIGHLHLL--L 57

  Fly    74 RDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKL-FGGE 137
            ..........|:.:||.:..:...:...::|::..:..|:...:...:|.|........| ||..
plant    58 SVLTHKSLQKLSSKYGPLLLIRIFYVPIILVSSSSMAYEIFKAHDVNVSSRGIIALDESLMFGAS 122

  Fly   138 RSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIK 202
            ...:....|:.:..:|.  :|.:...|:...    :...:..||:..:.|.:.::....|.:.|.
plant   123 GILNAPYGDYWKFMKKL--MATKLLRPQVLE----RSRGVRVEELHRFYRSILDKATKNESVEIG 181

  Fly   203 PLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPWLYPFYQRHLNK-- 265
            ...:|...|...:.:....|..|:.:..::....||.:       .|....:|....:|.|.|  
plant   182 KEAMKLMNNTLCKLIMGRSFSEDNGESNRVRGLVDETY-------ALSEKIFLAAILRRPLAKLR 239

  Fly   266 IINWSSTIRGF------IMERIIRHRELSVDLDEPDR---DFTDALLKSL----LEDKDVSRNTI 317
            |..:...|.|.      ::|||::.|:  .:|:|.:.   |..|.||::.    .|.|...::..
plant   240 ISLFKKEIMGVSNKFDELLERILQERK--ENLEEKNNEGMDMMDVLLEAYGDENAEYKITWKHIK 302

  Fly   318 IFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATI 382
            .|.:|.||||...........:|.:..|.::..|::|||.::: .|.|.|...|:..:||..|.:
plant   303 AFFVEFFIGGTDTSVQTTQWAMAEMINNANVLERLREEIVSVV-GETRLIQETDLPNLPYLQAVV 366

  Fly   383 FEVLR-YSSSPIVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKE 446
            .|||| :..||::.....|...:.|:.:.:.|.:.:|.|.:......|.:|::|.|.|||..|: 
plant   367 KEVLRLHPPSPVLIRKFQEKCEVKGFYIPEKTTLIVNVYAIMRDSDSWEDPEKFKPERFLTSSR- 430

  Fly   447 QSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNL 490
                      ||.|.:.|   ||     ||||..|:|.|.|.||
plant   431 ----------SGEEDEKE---LK-----FLPFGSGRRGCPGANL 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 108/453 (24%)
CYP705A3NP_193271.5 p450 15..509 CDD:299894 118/500 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.