DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP706A7

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_192970.1 Gene:CYP706A7 AraportID:AT4G12330 Length:518 Species:Arabidopsis thaliana

Alignment Length:578 Identity:138/579 (24%)
Similarity:235/579 (41%) Gaps:143/579 (25%)


  Fly    12 ILLSVLATS---YICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRY 73
            :|.:::.:|   ||. :|...:|:..|:                  .||||..||:|||      
plant    20 VLATIVISSVFWYIW-VYVKSKRLFPPL------------------PPGPRGLPIVGNL------ 59

  Fly    74 RDSPF------AGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMS---------- 122
               ||      ..|.:|||::|.::.|..|....:|:.:.|..|::|..|..:.:          
plant    60 ---PFLHPELHTYFHSLAQKHGPVFKLWLGAKLTIVITSSEATRDILRTNDVIFANDDVPVAGSL 121

  Fly   123 ---GRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYM---KMSQIGCEE 181
               |..|.:  ...:|.|         |..|        |:.|..:..|...:   ..|.:..:|
plant   122 STYGGVDIV--WSPYGPE---------WPML--------RKICINKMLSNATLDSNSFSALRRQE 167

  Fly   182 MEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQ- 245
            .....|.|.::...|..:|:...|.....|:.:|.:.. ....||.:.:::...|.|:..||.. 
plant   168 TRRTVRYLADRARAGLAVNVGEQIFVTILNVVTQMLWG-ETVADDEEREKVGAEFLELITEIIDV 231

  Fly   246 -GHP--LDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDR----DFTDALL 303
             |.|  .||.|.|..|..:.|.|.:..|:.....:.:|||..|   :.:|:..:    ||...||
plant   232 VGKPNVSDFFPVLSRFDLQGLAKRVRRSAQRMDRMFDRIISQR---MGMDKGSKGNGGDFLMVLL 293

  Fly   304 KSLLEDKDVSRNTIIFMLEDFI-GGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSI 367
            .:..||:::|.|.:..:|.|.: ||.....|.:...:|.:...::|.:|.|:|:|.:: .:|..:
plant   294 NAKDEDENMSMNHVKALLMDMVLGGTDTSLNTIEFAMAELINKLEIMKRAQQELDKVV-GKNNIV 357

  Fly   368 NLLDMNAMPYTMATIFEVLR-YSSSP-IVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWV 430
            ....:..:||.::.:.|.|| :.:.| ::|...:|.|||.||.:...:.||||.:.::.:...|.
plant   358 EEKHITKLPYILSIMKETLRLHPALPLLIPRCPSETTVIGGYTIPNDSKVFINVWAIHRNPNVWE 422

  Fly   431 NPKEFNPLRFLEPSKEQSPKNSKGSD-SGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQ------ 488
            ||.||||.|||:          ||.| ||            |...:.||..|:|.|.|.      
plant   423 NPLEFNPDRFLD----------KGYDFSG------------NDYSYFPFGSGRRICAGMAMAEKV 465

  Fly   489 ------NLVRGFGFLV----VVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTP 536
                  .|:..|.:.:    .|.:.:::.|      .:|:..          |||.||
plant   466 VLYNLATLLHSFDWRIGEGEKVELEEKFGI------LLKLKN----------PLVATP 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 131/532 (25%)
CYP706A7NP_192970.1 p450 55..517 CDD:299894 126/525 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.920

Return to query results.
Submit another query.