DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP71B36

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_189263.1 Gene:CYP71B36 AraportID:AT3G26320 Length:500 Species:Arabidopsis thaliana

Alignment Length:544 Identity:125/545 (23%)
Similarity:216/545 (40%) Gaps:128/545 (23%)


  Fly     8 TILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKY-TQAPGPRPWPIIGNLHLLD 71
            |||  .||:|..|  ||:...               ..|...|:: .:.|.|..:|||||||.|.
plant     3 TIL--FLSLLFLS--CILLAA---------------FTHKKRQQHQRKPPSPPGFPIIGNLHQLG 48

  Fly    72 RYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGG 136
               :.|......|:::||.:..|.||....:||::.|..::||..:......||.       ..|
plant    49 ---ELPHQSLWRLSKKYGHVMLLKFGSIPTVVVSSSETAKQVLKIHDLHCCSRPS-------LAG 103

  Fly   137 ERSNSLALCD---------WSQLQQKRRNLARRHCSPREFSCFYMKMSQ-IGCEEMEHWNRELGN 191
            .|:.|....|         |.:|        ||.|....||...::..| |..:|::.....:..
plant   104 PRALSYNYLDIAFSPFDDYWKEL--------RRICVQELFSVKRVQSFQPIKEDEVKKLIDSVSE 160

  Fly   192 QLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIV---QYFDEIFWE----INQGHPL 249
            ....|.|:|:.    :...::..:..|...|   .|:||..|   ..|:::..:    :......
plant   161 SASQGTPVNLS----EKFTSLTVRVTCKATF---GVNFQGTVLNSDRFEKLIHDTYLFLGSFSAS 218

  Fly   250 DFLP---WLYPFYQRHLNKIINWSSTIRGFIMERIIR----HRELSVDL-----DEPDRDFTDAL 302
            |:.|   |           ||:|.:.:.| ..||.:|    ..|...||     .|...||.|.|
plant   219 DYFPNGGW-----------IIDWLTGLHG-QRERSVRALDAFYEQMFDLHKQGNKEGVEDFVDLL 271

  Fly   303 LKSLLEDKD-------VSRNTI-IFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAI 359
            |:  ||.::       ::||.| ..::...|||.......:...:..:.:|..:.:::|.||...
plant   272 LR--LEKEETVIGYGKLTRNHIKAILMNVLIGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQ 334

  Fly   360 IEEENRSINLLDMNAMPYTMATIFEVLR-YSSSP-IVPHVATEDTVISGYGVTKGTIVFINNYVL 422
            |.::: .|.|.|::.:.|....|.|..| :..|| ::|.....:..::.|.:...|.:::|.:.:
plant   335 IGKKS-MITLDDIDQLHYLKMVINETWRLHPPSPFLIPRQVMSEFELNDYVIPVKTRLYVNVWAI 398

  Fly   423 NTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTC-- 485
            ......|.:|:||.|.||:              :|.|::..:..:|       |||..|:|.|  
plant   399 GRDPDTWKDPEEFLPERFV--------------NSSIDAKGQHFEL-------LPFGSGRRMCPA 442

  Fly   486 --IGQNLVRGFGFLVVVNVMQRYN 507
              :|..:|. ||   :.|::..::
plant   443 MYMGTTMVE-FG---LANMLYHFD 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 114/496 (23%)
CYP71B36NP_189263.1 p450 20..498 CDD:299894 116/509 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.920

Return to query results.
Submit another query.