DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP71B23

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_189252.1 Gene:CYP71B23 AraportID:AT3G26210 Length:501 Species:Arabidopsis thaliana

Alignment Length:565 Identity:126/566 (22%)
Similarity:216/566 (38%) Gaps:142/566 (25%)


  Fly     4 ALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLH 68
            ::....|.:||.:|.|    ||:           |:.|..      .|....|||...|||||||
plant     2 SIFLCFLLLLLLLLVT----IIF-----------TRKSQS------SKLKLPPGPPKLPIIGNLH 45

  Fly    69 LLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPD-----FI 128
            .|:   ..|......|.:.:|.:..|..|:...:|:::.:...|||..:......||:     .|
plant    46 YLN---GLPHKCLLNLWKIHGPVMQLQLGYVPLVVISSNQAAEEVLKTHDLDCCSRPETIASKTI 107

  Fly   129 RYH-KLFG----GERSNSLALCDWSQLQQKRRNLARRHC-SPREFSCF-YMKMSQIGCEEMEHWN 186
            .|: |..|    ||        :|..|    |.||.... |.::|:.| |::.     ||.:...
plant   108 SYNFKDIGFAPYGE--------EWRAL----RKLAVIELFSLKKFNSFRYIRE-----EENDLLV 155

  Fly   187 RELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFD--------YDDVDFQQIVQYFDEI---F 240
            ::|........|:|:|    ||...:.:..:|.|.|.        .|:...:.:....::|   |
plant   156 KKLSEASEKQSPVNLK----KALFTLSASIVCRLAFGQNLHESEFIDEDSMEDLASRSEKIQAKF 216

  Fly   241 WEINQGHPLDFLP--WLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALL 303
            ...|      |.|  |:       |:||...|.::           .|:..|||.......|..|
plant   217 AFSN------FFPGGWI-------LDKITGQSKSL-----------NEIFADLDGFFNQVLDDHL 257

  Fly   304 K---SLLEDKDVSRNTIIFML---------------------EDFIGGHSAVGNLVMLVLAYIAK 344
            |   .:||..||. :.:|.|:                     :.|:.|.:.....::..:..:.:
plant   258 KPGRKVLETPDVV-DVMIDMMNKQSQDGSFKLTTDHIKGIISDIFLAGVNTSATTILWAMTELIR 321

  Fly   345 NVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSP-IVPHVATEDTVISGY 407
            |..:.:::|:|:..::.|:...|...|:|.:.|....|.|..| :.::| ::|..|.....|.||
plant   322 NPRVMKKVQDEVRTVLGEKRDRITEQDLNQLNYFKLVIKETFRLHPAAPLLLPREAMAKIKIQGY 386

  Fly   408 GVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNI 472
            .:.:.|.:.:|.|.:......|.||:||.|.||:              ||.::......:|    
plant   387 DIPEKTQIMVNVYAIGRDPDLWENPEEFKPERFV--------------DSSVDYRGLNFEL---- 433

  Fly   473 PHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIK 517
               |||..|:|.|.|..:......|.::|::..::.......|:|
plant   434 ---LPFGSGRRICPGMTMGIATVELGLLNLLYFFDWGLPEGRTVK 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 116/514 (23%)
CYP71B23NP_189252.1 p450 40..500 CDD:299894 112/507 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.920

Return to query results.
Submit another query.