DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and UNE9

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_187667.1 Gene:UNE9 AraportID:AT3G10560 Length:514 Species:Arabidopsis thaliana

Alignment Length:541 Identity:118/542 (22%)
Similarity:219/542 (40%) Gaps:92/542 (17%)


  Fly     1 MLAALIY-TILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPII 64
            :|::.:: |||||::|.|..:   |.|          :..||..:|        ..|||..||:|
plant    13 LLSSNVFLTILAIIISGLLKT---ITY----------RKHNSNHLN--------LPPGPPGWPVI 56

  Fly    65 GNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIR 129
            |||....|.....|.....|.:.||.|.:|..|....:::::..|..|.|.:.|...:.||....
plant    57 GNLFQFTRSGKQFFEYVEDLVKIYGPILTLRLGTRTMIIISDASLAHEALIERGAQFATRPVETP 121

  Fly   130 YHKLFGGERSNSLALCD------WSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRE 188
            ..|:|.   |:.:.:..      |..|   |||:.:...|..       ::.:.|.......::.
plant   122 TRKIFS---SSEITVHSAMYGPVWRSL---RRNMVQNMLSSN-------RLKEFGSVRKSAMDKL 173

  Fly   189 LGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDF-----QQIVQYFDEIFWEI-NQGH 247
            :  :.:..|..:...|:.....:.::.:...|     |:.|     ::.::..|::...| |...
plant   174 I--ERIKSEARDNDGLVWVLQNSRYAAFCVLL-----DICFGVEMEEESIEKMDQLMTAILNAVD 231

  Fly   248 PL--DFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLK-SLLED 309
            |.  |:||.|.||.....|:.:.....:..|::..|.:.|:...........:.|.|.. .::|.
plant   232 PKLHDYLPILTPFNYNERNRALKLRRELVDFVVGFIEKRRKAIRTATVSSFSYLDTLFDLRIIEG 296

  Fly   310 KDV--SRNTIIFMLEDFI-GGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLD 371
            .:.  |...::.:..:|: .|....|..:...:|.:..|.:|..|:.:||.:.:.:  |:::..|
plant   297 SETTPSDEDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDEIKSTVGD--RAVDERD 359

  Fly   372 MNAMPYTMATIFEVLR-----YSSSPIVPHVATEDTVISGYGVTKGTIVFINNYVLNTSE--KFW 429
            ::.|....|.:.|:||     |.:   :.|..||.|.:|||.:..|  |.|..|:...||  |.|
plant   360 VDKMVLLQAVVKEILRRHPPTYFT---LSHGVTEPTTLSGYNIPVG--VNIEFYLPGISEDPKIW 419

  Fly   430 VNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGF 494
            ..||:|:|.|||...::.......|                  ...:||.:|:|.|.|..:....
plant   420 SEPKKFDPDRFLSGREDADITGVAG------------------VKMMPFGVGRRICPGMGMATVH 466

  Fly   495 GFLVVVNVMQRYNISSHNPST 515
            ..|::..::|.:...::.|.:
plant   467 VHLMIARMVQEFEWLAYPPQS 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 105/486 (22%)
UNE9NP_187667.1 PLN00168 46..512 CDD:215086 105/488 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.