DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and C4H

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_180607.1 Gene:C4H AraportID:AT2G30490 Length:505 Species:Arabidopsis thaliana

Alignment Length:567 Identity:116/568 (20%)
Similarity:217/568 (38%) Gaps:159/568 (28%)


  Fly     2 LAALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGN 66
            |..|..:::|:.::|:..:.|..:.|.|.::                      .|||.|.||.||
plant     3 LLLLEKSLIAVFVAVILATVISKLRGKKLKL----------------------PPGPIPIPIFGN 45

  Fly    67 -LHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRY 130
             |.:.|   |.........|:::||::.|..|....:||::.:|.:|||...|.....|...:.:
plant    46 WLQVGD---DLNHRNLVDYAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVVF 107

  Fly   131 HKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQL-- 193
             .:|.| :...:....:.:..:|.|.:       .....|..|:.|   :..|.|..|..:.:  
plant   108 -DIFTG-KGQDMVFTVYGEHWRKMRRI-------MTVPFFTNKVVQ---QNREGWEFEAASVVED 160

  Fly   194 VPGEP-------INIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIF----------- 240
            |...|       :..|.|.|....||| :.|...||:.:|          |.:|           
plant   161 VKKNPDSATKGIVLRKRLQLMMYNNMF-RIMFDRRFESED----------DPLFLRLKALNGERS 214

  Fly   241 -----WEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTD 300
                 :|.|.|   ||:|.|.||              :||:          |.:..|..||..  
plant   215 RLAQSFEYNYG---DFIPILRPF--------------LRGY----------LKICQDVKDRRI-- 250

  Fly   301 ALLKSLLEDK-----------------------------DVSRNTIIFMLEDFIGGHSAVGNLVM 336
            ||.|....|:                             :::.:.:::::|:.  ..:|:...:.
plant   251 ALFKKYFVDERKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENI--NVAAIETTLW 313

  Fly   337 LV---LAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSS-P-IVPH 396
            .:   :|.:..:.:|..:::.|:|.:: .....:...|::.:||..|.:.|.||...: | :|||
plant   314 SIEWGIAELVNHPEIQSKLRNELDTVL-GPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPH 377

  Fly   397 VATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIES 461
            :...|..::||.:...:.:.:|.:.|..:...|..|:||.|.||.|   |:|...:.|:|.    
plant   378 MNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFE---EESHVEANGNDF---- 435

  Fly   462 DNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNI 508
                        .::||.:|:|:|.|..|......:.:..::|.:.:
plant   436 ------------RYVPFGVGRRSCPGIILALPILGITIGRMVQNFEL 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 109/514 (21%)
C4HNP_180607.1 PLN02394 3..505 CDD:215221 116/568 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.