DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP71B6

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_179995.1 Gene:CYP71B6 AraportID:AT2G24180 Length:503 Species:Arabidopsis thaliana

Alignment Length:524 Identity:113/525 (22%)
Similarity:197/525 (38%) Gaps:125/525 (24%)


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||...||:||:|.|.   ..|......|:.:||.:.::..|..|.:||::.|...|||..:...
plant    38 PGPPRLPILGNIHQLG---SLPHRSLRDLSLKYGPVITVYLGSVRTVVVHSPETAEEVLKLHDSE 99

  Fly   121 MSGRP---------------------DFIR------YHKLFGGERSNSLALCDWSQLQQKRRNLA 158
            ...||                     |:.|      ..:||..:|:||.            ||: 
plant   100 CCTRPKLSITKSFFYDGLGLGFTKWGDYYRDVRKLCVLELFSVKRANSF------------RNI- 151

  Fly   159 RRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFD 223
                  ||             ||:........:....|..:::...:.|..|:...:....|.|.
plant   152 ------RE-------------EELSRLVNSFSDSASSGSSVDLTANLAKFVASFTCRMAFGLSFQ 197

  Fly   224 YDDVDFQQIVQYFDEIFWEINQGHPLDFLP---WLYPFYQRHLNKIINWSSTIR-------GFIM 278
            ...:|.:..::.|.|....|.:....|..|   |:       |::|....|:.|       .|..
plant   198 GSGMDNETFLELFTEANRVIGKFAAADIFPGFGWI-------LDRISGLDSSRRKSFQDLDTFYQ 255

  Fly   279 ERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTI------IFMLEDFIGGHSAVGNLVML 337
            :.|:.|||.....|.  .|..|.|||...::..:..:.|      ..:::.|:.|.......:..
plant   256 KAIVDHREKKKTEDR--EDLIDVLLKLQSQETKLGSSRITDTHIRAIIMDLFVAGVDTSVITLDW 318

  Fly   338 VLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSPI-VPHVATE 400
            .:|.::::..:.:::|.||...:.::. .:...|:.|:.|....|.|..| ::.||| :|..|..
plant   319 TMAELSRHPRVMKKVQAEIREHVGDKG-IVTYDDLEALVYMKMVIKETWRLHAPSPILIPREAMT 382

  Fly   401 DTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEK 465
            :..|.||.:..||.:.:|.:.:..:...|.:|.||.|.||:              ||.:|:....
plant   383 NFKIKGYDIYPGTRIHVNAWAIGRNPDVWKDPDEFIPERFV--------------DSNVETKGTS 433

  Fly   466 LQLKRNIPHFLPFSIGKRTC----IG--------QNLVRGFGFLVV--VNVMQRYNISSHNPSTI 516
            .:|       |||..|:|.|    :|        .||:..|.:...  |:|.:...::||....:
plant   434 FEL-------LPFGSGRRGCPAMYVGLSTVEYTLANLLYHFDWKATEEVSVEEAPGLTSHRKHPL 491

  Fly   517 KISP 520
            .:.|
plant   492 HLVP 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 113/525 (22%)
CYP71B6NP_179995.1 p450 36..499 CDD:299894 113/525 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.