DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and cyp17a2

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001099140.1 Gene:cyp17a2 ZFINID:ZDB-GENE-100822-1 Length:495 Species:Danio rerio

Alignment Length:549 Identity:153/550 (28%)
Similarity:254/550 (46%) Gaps:82/550 (15%)


  Fly     7 YTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGN-LHLL 70
            ::.|.:||.:|.           ||:|:.|   .|:.::....        || .|::|: ||| 
Zfish    10 FSALLLLLLLLV-----------RRLLEGV---GSSSVSFPCL--------PR-LPLLGSLLHL- 50

  Fly    71 DRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFG 135
             |....|...||.|:.|||.::.|..|....|||:.:.|:||||.|.|:..:|||..:....|..
Zfish    51 -RSNLPPHLLFTQLSSQYGPLFGLYAGPHLTLVVSEIGLVREVLLQRGREFAGRPKMVTTDLLTQ 114

  Fly   136 GERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPIN 200
            |  ...:|..|:|.|.:..|.|.  |.|...|.....|:..|..|..:....||  |...|:..:
Zfish   115 G--GKDIAFADYSPLWKNHRRLV--HSSFTLFGEGSNKLQTIVQEAADSLCEEL--QACRGQSSD 173

  Fly   201 IKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPWLYPFYQRHLNK 265
            :..::::|..|:..:.:.|..:...|.:.|.::||.|.|...|.:|..:|..|||..|..:.|.:
Zfish   174 LSVVLMRAVTNVICRLVFSSSYQPSDPELQTVIQYNDGIVQTIARGGLVDIFPWLRIFPNKDLKR 238

  Fly   266 IINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALL----------KSLLEDKDVSRNTIIFM 320
            :....|.....:.::::.|:: |:...|| ||..||||          ..:.||     :.::..
Zfish   239 LKECVSIRDQLLYKKLLEHKK-SLTPGEP-RDLLDALLIGQQRGSGGADDITED-----HVLMTA 296

  Fly   321 LEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEV 385
            .|.|..|.......::..:|::..:..:..|:|.|:|..:..: |...|.|...:|...|.:.||
Zfish   297 AEAFGAGVETTSTTLLWTIAFLLHHPQLQERVQAELDECVGVD-RPPCLSDRPHLPLLDAVLCEV 360

  Fly   386 LRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQS 448
            :|... ||| :||||.:||.:.|:.|.|||.|.:|.:.::...|.|..|::|||.||||||.::.
Zfish   361 MRIRPVSPILIPHVAMQDTSLGGHSVPKGTRVLVNMWAIHHDPKHWDQPEQFNPERFLEPSGKKK 425

  Fly   449 PKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNP 513
            .::|                      ||||..|.|.|:|::|.|...||.|...:||::.|..:.
Zfish   426 TQSS----------------------FLPFGAGPRVCVGESLARIELFLFVSRPLQRFSFSCPSE 468

  Fly   514 STIKISPE-----SLALPADCFPLVLTPR 537
            :::   |:     .:.|..:.:.:.:|||
Zfish   469 ASL---PDLQGRFGVVLQPERYTVTVTPR 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 144/501 (29%)
cyp17a2NP_001099140.1 p450 55..491 CDD:278495 133/475 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H107154
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.