DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and cyp2a13

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_012819484.1 Gene:cyp2a13 XenbaseID:XB-GENE-5892286 Length:489 Species:Xenopus tropicalis

Alignment Length:562 Identity:131/563 (23%)
Similarity:231/563 (41%) Gaps:118/563 (21%)


  Fly    14 LSVLATSYIC-----IIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRY 73
            :::|.:::||     :::|.||.|.|                  ...|||||.|:||||.|:|  
 Frog     7 MTILLSAFICLLLGFVLFGRKRNVCQ------------------NFPPGPRPLPVIGNLLLMD-- 51

  Fly    74 RDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIRE-VLNQNGKVMSGRP------DFIRYH 131
            |..|:.....::::||.:.|...|..:.:|:...:.::: :||..   .:.||      |..:.|
 Frog    52 RKQPYKALLKVSKKYGPVCSFQIGPLKTVVLCGYDTVKDALLNDE---FADRPAMPMLDDVAKGH 113

  Fly   132 KLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVP- 195
            .:......|      |..:              |.|:...::...:|.:.:|....|..:.||. 
 Frog   114 GILSSNGEN------WRVM--------------RRFALSTLRDFGMGKKTIESKINEECDHLVQK 158

  Fly   196 -----GEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPWL 255
                 |:|.:...::..|.||:.:..:.|.||.|::....::::..:|     |.......:..|
 Frog   159 FSSYGGKPFDTTMIMNAAVANIIASILLSHRFQYENPTLLRLLKLVNE-----NTKFMASRIAML 218

  Fly   256 YPFYQRHLNKIINW-----------SSTIRGFIMERIIRHRELSVDLDEPD-RDFTDALLKSLLE 308
            |..:.    .|:.|           :..:..||.|...:.:   |:||..| |:..||.|....|
 Frog   219 YNTFP----SIMRWIPGCHKSIYKNAQELLEFIRETFSKQK---VELDINDQRNLIDAFLSRQQE 276

  Fly   309 DKD----VSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAII-EEENRSIN 368
            ...    ...|..|.:.:.|:.|.......:...|..:.|..:|.:::|:||:.:| ..|.|:.:
 Frog   277 PNSGKYFHDDNLTILVFDLFVAGMETTSTTLRWALLLMMKYPEIQKKVQDEIEKVIGSAEPRAEH 341

  Fly   369 LLDMNAMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVN 431
            ..|   ||||.|.|.|:.|::: .|: .||..|:|....|:.:.|||.|......:...|.::..
 Frog   342 RKD---MPYTDAVIHEIQRFANIFPMNGPHATTKDVTFRGFLIPKGTFVIPLLASVLKDENYFRK 403

  Fly   432 PKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGF 496
            |.||.|..||: |:....||..                     |||||.|:|:|.|:||.|...|
 Frog   404 PNEFYPEHFLD-SEGHFVKNDA---------------------FLPFSAGRRSCAGENLARMELF 446

  Fly   497 LVVVNVMQRYNISSHNPSTIKISPE-SLALPADCFPLVLTPR 537
            |...:::|.:...:.....:.::|: .:|.|.....:...||
 Frog   447 LFFTSLLQNFTFQAPPGEELDLTPDVGIATPPMQHTVCALPR 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 123/516 (24%)
cyp2a13XP_012819484.1 p450 35..483 CDD:278495 121/510 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.