DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and Cyp2c22

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_612521.1 Gene:Cyp2c22 RGDID:620368 Length:489 Species:Rattus norvegicus

Alignment Length:561 Identity:145/562 (26%)
Similarity:236/562 (42%) Gaps:113/562 (20%)


  Fly     6 IYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLL 70
            ::..|.|.||.|...::...:.|:|::                      .|||.|.||.||  :|
  Rat     3 LFIFLGIWLSCLVFLFLWNQHHVRRKL----------------------PPGPTPLPIFGN--IL 43

  Fly    71 DRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFG 135
            .....:.......||::||.::::..|....:|:...|:::|.|...|:..|.     :.|....
  Rat    44 QVGVKNMSKSMCMLAKEYGPVFTMYLGMKPTVVLYGYEVLKEALIDRGEEFSD-----KMHSSML 103

  Fly   136 GERSNSLALC-----DWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVP 195
            .:.|..|.:.     .|.|              .|.||...::...:|...:|:..:|....|:.
  Rat   104 SKVSQGLGIVFSNGEIWKQ--------------TRRFSLMVLRSMGMGKRTIENRIQEEVVYLLE 154

  Fly   196 ------GEPINIKPLILKAC--ANMFSQYMCSLRFDYDDVDFQQIVQYFD---EIF---W-EINQ 245
                  |.|.:  |..|.||  .|:.|..:...||||.|..||:.::.|.   ||.   | ::..
  Rat   155 ALRKTNGSPCD--PSFLLACVPCNLISSVIFQHRFDYSDEKFQKFIENFHTKIEILASPWAQLCS 217

  Fly   246 GHP-LDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLED 309
            .:| |.:||.::       ||.:...:..:.||:..|.||| .|::|..| :||.|..|..:.::
  Rat   218 AYPVLYYLPGIH-------NKFLKDVTEQKKFILMEINRHR-ASLNLSNP-QDFIDYFLIKMEKE 273

  Fly   310 K-----DVSRNTIIFMLEDFIG-GHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSIN 368
            |     :.:.:.:|..:.|..| |.....:.:...|..:.|..::..:|||||..:|....|.. 
  Rat   274 KHNEKSEFTMDNLIVTIGDLFGAGTETTSSTIKYGLLLLLKYPEVTAKIQEEITRVIGRHRRPC- 337

  Fly   369 LLDMNAMPYTMATIFEVLRY-SSSPI-VPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVN 431
            :.|.|.||||.|.:.|:.|| ...|| :|...|:|....||.:.|||.|..........:|.:.|
  Rat   338 MQDRNHMPYTDAVLHEIQRYIDFVPIPLPRKTTQDVEFRGYHIPKGTSVMACLTSALHDDKEFPN 402

  Fly   432 PKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGF 496
            |::|:|..||:     ...|.|.||                 :|:.||.|:|.|||:.|.|...|
  Rat   403 PEKFDPGHFLD-----EKGNFKKSD-----------------YFMAFSAGRRACIGEGLARMEMF 445

  Fly   497 LVVVNVMQRYNISS-HNP---STIKISPESLALPAD---CF 530
            |::.:::|.:.:.. .||   .|..:.|..|:||..   ||
  Rat   446 LILTSILQHFILKPLVNPEDIDTTPVQPGLLSLPPPFQLCF 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 138/512 (27%)
Cyp2c22NP_612521.1 p450 30..486 CDD:278495 137/511 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116136451
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.