DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and CYP1B1

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_000095.2 Gene:CYP1B1 HGNCID:2597 Length:543 Species:Homo sapiens

Alignment Length:566 Identity:150/567 (26%)
Similarity:255/567 (45%) Gaps:93/567 (16%)


  Fly     8 TILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDR 72
            |.|.:|||||||.:      |.:|:|:           ....|..:..|||..||:|||...:.:
Human    21 TTLLLLLSVLATVH------VGQRLLR-----------QRRRQLRSAPPGPFAWPLIGNAAAVGQ 68

  Fly    73 YRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGE 137
               :....|..||::|||::.:..|....:|:|....|.:.|.|.|...:.||.|..:..:.|| 
Human    69 ---AAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAFASFRVVSGG- 129

  Fly   138 RSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEP---- 198
              .|:|...:|:..:.:|..|  |...|.|.....:..|:....:....|||...||.|..    
Human   130 --RSMAFGHYSEHWKVQRRAA--HSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAF 190

  Fly   199 INIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPWLYPFYQ--- 260
            ::.:||.:.|.||:.|......|:.:||.:|::::.:.:|....:..|..:|.:|||..|..   
Human   191 LDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVR 255

  Fly   261 ------RHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSL------------- 306
                  ..||:  |:|:    ||:::.:||.| |:......||..||.:.|.             
Human   256 TVFREFEQLNR--NFSN----FILDKFLRHCE-SLRPGAAPRDMMDAFILSAEKKAAGDSHGGGA 313

  Fly   307 ---LEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSIN 368
               ||:...:...|....:|.:.  :|:..|::|...|    .|:..|:|.|:|.::..: |...
Human   314 RLDLENVPATITDIFGASQDTLS--TALQWLLLLFTRY----PDVQTRVQAELDQVVGRD-RLPC 371

  Fly   369 LLDMNAMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVN 431
            :.|...:||.:|.::|.:|:|| .|: :||..|.:|.:.||.:.|.|:||:|.:.:|.....|.|
Human   372 MGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPN 436

  Fly   432 PKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNL--VRGF 494
            |:.|:|.|||                    |.:.|..|......:.||:|||.|||:.|  ::.|
Human   437 PENFDPARFL--------------------DKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLF 481

  Fly   495 GFLVVVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTPREKI 540
            .|:.::.....:..:.:.|:.:..| ..|.:....|.:.:|.||.:
Human   482 LFISILAHQCDFRANPNEPAKMNFS-YGLTIKPKSFKVNVTLRESM 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 137/517 (26%)
CYP1B1NP_000095.2 p450 51..520 CDD:278495 134/512 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4653
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.676 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.