DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and Cyp2f2

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_031843.2 Gene:Cyp2f2 MGIID:88608 Length:491 Species:Mus musculus

Alignment Length:546 Identity:141/547 (26%)
Similarity:238/547 (44%) Gaps:106/547 (19%)


  Fly    11 AILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRYRD 75
            ||||.:||...:.:.:..:.:...|                    |||:|.||:|||..| |.:|
Mouse     7 AILLLLLAVISLSLTFSSRGKGQLP--------------------PGPKPLPILGNLLQL-RSQD 50

  Fly    76 SPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGERSN 140
            . ....|.|:::||.::::..|....:|::..:.::|.|...|:..|||.   .|...|...|.|
Mouse    51 L-LTSLTKLSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRG---AYPVFFNFTRGN 111

  Fly   141 SLALCD---WSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQL------VPG 196
            .:|..|   |..|              |.||...::...:|...:|....|.|:.|      :.|
Mouse   112 GIAFSDGERWKIL--------------RRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKMEG 162

  Fly   197 EPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPW--LYPFY 259
            :|.:...::.::.:|:....:...||||||.....|:.:       ||....:...||  :|..:
Mouse   163 KPFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIHF-------INDNFKIMSSPWGEMYNIF 220

  Fly   260 QRHLNKIINW-----SSTIRGF-----IMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKD--- 311
            .    .:::|     ....|.|     ::.|.:|..:.|:|.:.| |||.|..|..:.::|.   
Mouse   221 P----SVLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSP-RDFIDCFLTKMAQEKQDPL 280

  Fly   312 --VSRNTIIFMLEDFI-GGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMN 373
              .:.:|::....:.: ||...||..:......:.|...:..|:|||||.:: ..:|...|.|..
Mouse   281 SHFNMDTLLMTTHNLLFGGTETVGTTLRHAFLILMKYPKVQARVQEEIDRVV-GRSRMPTLEDRT 344

  Fly   374 AMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGT-IVFINNYVLNTSEKFWVNPKEF 435
            :||||.|.|.||.|::. .|: :||..|.||...|:.:.||| ::.:.|.|...|::| ..|:||
Mouse   345 SMPYTDAVIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPKGTDVITLLNTVHYDSDQF-KTPQEF 408

  Fly   436 NPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVV 500
            ||..||:                   ||...   :..|.|:|||.|:|.|:|:.|.|...|:...
Mouse   409 NPEHFLD-------------------DNHSF---KKSPAFMPFSAGRRLCLGEPLARMELFIYFT 451

  Fly   501 NVMQRYNISS-HNPSTIKISPESLAL 525
            :::|.:.:.. .:|..|.::|.|..|
Mouse   452 SILQNFTLQPLVDPEDIDLTPLSSGL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 134/502 (27%)
Cyp2f2NP_031843.2 p450 31..488 CDD:278495 135/523 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C101070149
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.