DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and Cyp2d10

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_034135.2 Gene:Cyp2d10 MGIID:88602 Length:504 Species:Mus musculus

Alignment Length:558 Identity:137/559 (25%)
Similarity:238/559 (43%) Gaps:108/559 (19%)


  Fly     6 IYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQ--APGPRPWPIIGNLH 68
            |:|::.|||                           .::.|. :|::|.  .|||.|||::|||.
Mouse    14 IFTVIFILL---------------------------VDLMHR-HQRWTSRYPPGPVPWPVLGNLL 50

  Fly    69 LLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKL 133
            .:| ..:.|::.: .|..:|||::||..|....:|:|.|:.::|||...|:..:.||....:..|
Mouse    51 QVD-LDNMPYSLY-KLQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADRPQVPIFEYL 113

  Fly   134 FGGERSNSLALC----DWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLV 194
            .....|..:.|.    :|.:              .|.||...::...:|.:.:|.|..:....|.
Mouse   114 GVKPGSQGVVLAPYGPEWRE--------------QRRFSVSTLRNFGLGKKSLEDWVTKEARHLC 164

  Fly   195 ------PGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHP--LDF 251
                  .|:|||...::..|..|:.:..:.:.||:|:|....::.:..::...||:...|  |:.
Mouse   165 DAFTAQAGQPINPNTMLNNAVCNVIASLIFARRFEYEDPYLIRMQKVLEDSLTEISGLIPEVLNM 229

  Fly   252 LPWL-----YPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALL------KS 305
            .|.|     .|      .|:.....::.. |:|.::.....:.|.|:|.|:.|||.|      |.
Mouse   230 FPILLRIPGLP------GKVFQGQKSLLA-IVENLLTENRNTWDPDQPPRNLTDAFLAEIEKVKG 287

  Fly   306 LLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLL 370
            ..|......|..:.:|:.|..|.......:...|..:..:.|:.||:|:||||:|.:. |...:.
Mouse   288 NAESSFNDENLRMVVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRVQQEIDAVIGQV-RHPEMA 351

  Fly   371 DMNAMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPK 433
            |...||||.|.|.||.|:.. :|: :|.:.:.|..:..:.:.||:|:..|...:...|..|..|.
Mouse   352 DQARMPYTNAVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPKGSILIPNMSSVLKDETVWEKPL 416

  Fly   434 EFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLV 498
            .|:|..||:         ::|.....|:             |:|||.|:|:|:|:.|.|...||.
Mouse   417 RFHPEHFLD---------AQGHFVKPEA-------------FMPFSAGRRSCLGEPLARMELFLF 459

  Fly   499 VVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTP 536
            ...::|.::.|..|...   .|.:|.:    ||..:.|
Mouse   460 FTCLLQHFSFSVPNGQP---RPRNLGV----FPFPVAP 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 129/507 (25%)
Cyp2d10NP_034135.2 p450 37..496 CDD:278495 129/508 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116089250
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.