DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and Cyp2c37

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_034131.2 Gene:Cyp2c37 MGIID:1306806 Length:490 Species:Mus musculus

Alignment Length:515 Identity:146/516 (28%)
Similarity:235/516 (46%) Gaps:90/516 (17%)


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||.|.|||||:..:| .:|. ...||.|::.||.:|:|..|....:|::..|.::|.|..:|:.
Mouse    31 PGPTPLPIIGNILQID-VKDI-CQSFTNLSKVYGPVYTLYLGRKPTVVLHGYEAVKEALVDHGEE 93

  Fly   121 MSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHW 185
            .:||..|..:.|...|   ..||....:..:..||           ||...::...:|...:|..
Mouse    94 FAGRGRFPVFDKATNG---MGLAFSKGNVWKNTRR-----------FSLMTLRNLGMGKRSIEDR 144

  Fly   186 NRELGNQLVP------GEPINIKPLILKACANMFSQYMCSL----RFDYDDVDFQQIVQYFDEIF 240
            .:|....||.      |.|.:  |..:..||.  ...:||:    ||||.|.||..:::..:||.
Mouse   145 VQEEARCLVEELRKTNGSPCD--PTFILGCAP--CNVICSIIFQDRFDYKDRDFLNLMEKLNEIT 205

  Fly   241 ------W-EINQGHP--LDFLPWLY-PFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPD 295
                  | :|...:|  ||:.|..: .|::.:        ::|:.|::|:|..|.| |:|:..| 
Mouse   206 KILSSPWLQICNTYPALLDYCPGSHKQFFKNY--------ASIKNFLLEKIKEHEE-SLDVTIP- 260

  Fly   296 RDFTD-ALLKSLLED-----KDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQE 354
            |||.| .|:....||     ::...:..|.:.:.|..|.......:...:..:.|...:..::||
Mouse   261 RDFIDYFLINGGQEDGNQPLQNRLEHLAITVTDLFSAGTETTSTTLRYAILLLLKYPHVTAKVQE 325

  Fly   355 EIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSS--SPIVPHVATEDTVISGYGVTKGTIVFI 417
            ||:.:| .::||..:.|.:.||||.|.|.||.|:..  ...:||..|.|.....|.:.|||.|..
Mouse   326 EIEHVI-GKHRSPCMQDRSRMPYTDAMIHEVQRFIDLIPNSLPHEVTSDIKFRNYFIPKGTTVIT 389

  Fly   418 N-NYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIG 481
            : :.||:.|.:| .||::|:|..||:       :|.|...|               .:|:|||.|
Mouse   390 SLSSVLHDSTEF-PNPEKFDPGHFLD-------ENGKFKKS---------------DYFIPFSTG 431

  Fly   482 KRTCIGQNLVRGFGFLVVVNVMQRYNISS-HNPSTIKISPESLAL----PADCFPLVLTP 536
            ||.|.|:.|.|...||.:.:::|.:|:.. .:|..|.::|..:.|    ||  |.|...|
Mouse   432 KRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDVTPMLIGLASVPPA--FQLCFIP 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 146/516 (28%)
Cyp2c37NP_034131.2 p450 30..487 CDD:278495 145/512 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.