DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and LOC100148115

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001315620.1 Gene:LOC100148115 ID: Length:496 Species:Danio rerio

Alignment Length:535 Identity:146/536 (27%)
Similarity:227/536 (42%) Gaps:107/536 (20%)


  Fly     1 MLAALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIG 65
            ||.||:...|...|..|           :.|:.:|   ||.             .|||.|.||.|
Zfish     1 MLTALVLLCLGAFLLYL-----------QLRIRRP---KNF-------------PPGPAPVPIFG 38

  Fly    66 NLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRY 130
            ||..|:|.  ||...|...||.||.||.:..|....:|:...::|:|.|.......|||.:.:.:
Zfish    39 NLLQLNRI--SPLKDFDKFAQHYGSIYGIYIGSQPAVVLTGQKMIKEALITQAAEFSGRSNNMMF 101

  Fly   131 HKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVP 195
            ..:.||:   .:.:.|:.:..::.|..|.  .:.|.|......|.|...||::|....|...  .
Zfish   102 SHVTGGK---GVIMADYGESWREHRRFAL--TTLRNFGLGKKSMEQRILEEVKHICLLLEES--A 159

  Fly   196 GEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPW--LY-- 256
            |:.|:.:.|..:|.:|:.:..:...||:|.|..||.::...::: .:|..|      ||  ||  
Zfish   160 GKSIDPQHLYHQAASNIIASIIFGSRFNYKDAYFQTLITSVEDL-TKITIG------PWAMLYEI 217

  Fly   257 ---------PFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDV 312
                     ||     .|...:...|...:::.:..|:...| ..|| ||..|..|:. :|:|..
Zfish   218 APVLRIFPLPF-----QKAFQYFEQITKHVLKVVEEHKTSRV-AGEP-RDLIDCYLEE-MENKSD 274

  Fly   313 SRN--------TIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINL 369
            .|.        |::|.|  ||.|.....|.:..:..|:.....|..:.|.|||.::...:. :..
Zfish   275 HRTSFDESQMVTLLFDL--FIAGTETTSNTLRTLTLYLMTYTHIQEQCQREIDEVLGARDH-VTY 336

  Fly   370 LDMNAMPYTMATIFEVLRYSSSPIVP----HVATEDTVISGYGVTKGTIV--FINNYVLNTSEKF 428
            .|.|||.:..|.|.|..|.:.  |.|    |.|..||.:.||.:.||||:  ::::.:...|:  
Zfish   337 EDRNAMHFVQAVIHEGQRVAD--IAPLSMFHSAKTDTQLRGYSIPKGTIIIPYLSSSLREESQ-- 397

  Fly   429 WVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRG 493
            |..|.||||..||                     |||.:..:| ..|:|||.|.|.|:|:||.|.
Zfish   398 WKFPHEFNPQNFL---------------------NEKGEFVKN-DAFMPFSAGPRVCLGENLARM 440

  Fly   494 FGFLVVVNVMQRYNI 508
            ..||::|.|::|:.:
Zfish   441 ELFLILVTVLRRFRL 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 135/481 (28%)
LOC100148115NP_001315620.1 p450 28..483 CDD:278495 135/482 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.