DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spo and cyp17a1

Sequence 1:NP_001286943.1 Gene:spo FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001120517.1 Gene:cyp17a1 XenbaseID:XB-GENE-1006797 Length:511 Species:Xenopus tropicalis

Alignment Length:466 Identity:123/467 (26%)
Similarity:208/467 (45%) Gaps:55/467 (12%)


  Fly    62 PIIGN-LHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRP 125
            |.||: |||....  :|...|..|.::||.:||...|....::||:.|..:|||.:.||...|||
 Frog    41 PFIGSLLHLASHL--APHILFNKLQEKYGSLYSFKMGSHYIVIVNHHEHAKEVLLKKGKTFGGRP 103

  Fly   126 DFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELG 190
            ..:....|  ...:..:|..|:|...:..|.|.  |.:...|....:.:.:|...|.    ..|.
 Frog   104 RAVTTDLL--TRNAKDIAFADYSPTWKFHRKLV--HAALSMFGEGTVAIEKIISREA----ASLC 160

  Fly   191 NQLV--PGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLP 253
            ..|:  .|.|:::.|.:.:|..|:......:.|:...|.:|::::.|...|...:.:...:|..|
 Frog   161 QTLITFQGSPLDMAPELTRAVTNVVCALCFNARYKRCDPEFEEMLAYSKGIVDTVAKDSLVDIFP 225

  Fly   254 WLYPFYQRHLNKIINWSSTIRGFIMERIIR-HRELSVDLDEPDRDFTDALLKSLLEDKDVSRNT- 316
            ||..|..:.| :|:..|..||..::::.:: |:|  ....|...|..|||||:.|..::.:.|. 
 Frog   226 WLQIFPNKDL-EILKRSVAIRDKLLQKKLKEHKE--AFCGEEVNDLLDALLKAKLSMENNNSNIS 287

  Fly   317 ---------IIFMLEDFIG-GHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLD 371
                     ::..:.|..| |......::...:||:.....:..:||||:|..:......: |.|
 Frog   288 QEVGLTDDHLLMTVGDIFGAGVETTTTVLKWAVAYLLHYPKVQAKIQEELDVKVGFGRHPV-LSD 351

  Fly   372 MNAMPYTMATIFEVLRYSS-SP-IVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKE 434
            ...:||..|||.||||... :| ::||||..::.|..|.:.:...|.||.:.|:.....|.||:|
 Frog   352 RRILPYLDATISEVLRIRPVAPLLIPHVALHESSIGEYTIPQDARVVINLWSLHHDPNEWENPEE 416

  Fly   435 FNPLRFLEPSKEQ--SPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFL 497
            |.|.|||:.:...  :|..|                      :|||..|.|.|:|:.|.:...||
 Frog   417 FIPDRFLDENGNHLYTPSQS----------------------YLPFGAGIRVCLGEALAKMEIFL 459

  Fly   498 VVVNVMQRYNI 508
            .:..::||:.:
 Frog   460 FLSWILQRFTL 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 123/467 (26%)
cyp17a1NP_001120517.1 p450 34..497 CDD:278495 123/467 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.