DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bc10 and blcap

DIOPT Version :10

Sequence 1:NP_647972.1 Gene:bc10 / 38628 FlyBaseID:FBgn0040239 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001011288.1 Gene:blcap / 496741 XenbaseID:XB-GENE-964352 Length:87 Species:Xenopus tropicalis


Alignment Length:76 Identity:49/76 - (64%)
Similarity:56/76 - (73%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCLQCLLPVLLIPKPSNPALMETHVMFIVLYLVGFFLERKPCTICSLVFLTAVSLICYSGVGNC 65
            |||||.||||||||||.||||..:|.:|:..||:.|.|||||||||:||||.|:.|||||    |
 Frog     1 MYCLQWLLPVLLIPKPLNPALWFSHSVFMGFYLLSFLLERKPCTICALVFLGALFLICYS----C 61

  Fly    66 IFWGNCEGHQC 76
              ||||..:.|
 Frog    62 --WGNCFLYHC 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bc10NP_647972.1 BC10 1..65 CDD:369052 43/63 (68%)
blcapNP_001011288.1 BC10 1..65 CDD:369052 46/69 (67%)

Return to query results.
Submit another query.