DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: blanks and ZFR

Sequence 1:NP_647966.1 Gene:blanks FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_057191.2 Gene:ZFR HGNCID:17277 Length:1074 Species:Homo sapiens

Alignment Length:223 Identity:49/224 (22%)
Similarity:78/224 (35%) Gaps:47/224 (21%)


  Fly    61 SSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDALMV 125
            |:||..:| |.|||..|:.:|.....||....:...|.......:.|.      :..|...:|..
Human   422 STEPNVVS-QATSSTAVSASKPTASPSSIAANNCTVNTSSVATSSMKG------LTTTGNSSLNS 479

  Fly   126 LNELKGVTV-DNMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEILTTKMKAVL 189
            .:..|...| .||..|:....||.   .|...|.::.|:.....:...|.|      :|.:.:.:
Human   480 TSNTKVSAVPTNMAAKKTSTPKIN---FVGGNKLQSTGNKAEDIKGTECVK------STPVTSAV 535

  Fly   190 DGPGKSLESDEDDILEKM--ASYAI---------HKLGEEWKTDDIDVATL--------YND--- 232
            ..|    |..:|.:.|.:  ||.|.         |...||.:.|:..|...        :||   
Human   536 QIP----EVKQDTVSEPVTPASLAALQSDVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNA 596

  Fly   233 ----LKNKQTSVVEPKKPLPETWKNMHP 256
                ||.::..:...||..|:....:.|
Human   597 KEMHLKGRRHRLQYKKKVNPDLQVEVKP 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ZFRNP_057191.2 ZnF_U1 331..360 CDD:197732
ZnF_U1 384..413 CDD:197732
Epiglycanin_TR 420..477 CDD:283334 15/62 (24%)
ZnF_U1 581..612 CDD:197732 4/31 (13%)
C2H2 Zn finger 584..606 CDD:275371 4/22 (18%)
DZF 784..1038 CDD:128842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121631529
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.