DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: blanks and Zn72D

Sequence 1:NP_647966.1 Gene:blanks FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001261924.1 Gene:Zn72D FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster

Alignment Length:326 Identity:63/327 (19%)
Similarity:125/327 (38%) Gaps:63/327 (19%)


  Fly     3 AKQLL--AESCAKVDILEMKKALIPNPSAEEDAVAVIPLADNLKKTAMGGENKSDEKGTVSSEPK 65
            ||.||  .::..::.:|..:|   |.....:....|:|  |.||:.|  |:.:.:.:..|::|..
  Fly   588 AKGLLLHGDNAVELVVLCAEK---PTSGLLQRVANVLP--DKLKEVA--GDTQVNYRVEVNAEEA 645

  Fly    66 A---LSDQITSSMRVTKNKIADDKSSDVITDDATNGRK---------------KQKKNKKAKIRP 112
            |   |.:.::..:.:|...:.|....:..|.|...|..               :..|..:|:...
  Fly   646 ALIVLDESVSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATG 710

  Fly   113 LTMPVTSKDALMVLNELKGV--TVDNMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEK 175
            |      :..:||:..|:.:  .|.:.|.......:::...|::|..:......        |.:
  Fly   711 L------QSCVMVIRILRDLCQRVSSWQSLPQWSLELLVEKVISSAGFPISPGD--------CMR 761

  Fly   176 ALQEILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLY-NDLKNKQTS 239
            .:.|.|::..  :::|||..      |..||..:.|:.:|.::.:.|....|.|: ..:..:|..
  Fly   762 RIMEALSSGF--LINGPGLL------DPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIY 818

  Fly   240 VVEPKKPLPETWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAA 304
            .|...:|||.....|.|..| |..|.:.:....|..||.          .::.:.:..|..:|.|
  Fly   819 KVLGMEPLPAMKFPMRPWRV-NRKRRRSSGKAGGAPGTE----------TESNDIDETGSDEKVA 872

  Fly   305 R 305
            :
  Fly   873 K 873

Known Domains:


GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 52/270 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121433962
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.