DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blanks and ILF3

DIOPT Version :9

Sequence 1:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001381737.1 Gene:ILF3 / 3609 HGNCID:6038 Length:898 Species:Homo sapiens


Alignment Length:290 Identity:73/290 - (25%)
Similarity:113/290 - (38%) Gaps:44/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLADNLKKTAMGGENKSDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKK- 101
            ||...:.|..   :|::....||...|..     |.::...|..:.:|      .::.:..:|| 
Human   338 PLPSKMPKKP---KNENPVDYTVQIPPST-----TYAITPMKRPMEED------GEEKSPSKKKK 388

  Fly   102 --QKKNKKAKIRPLTMPVTSKDALMVLNELKGVTVDNMQIKR-DHEGKIMA-----RVVVNSKKY 158
              |||.:||:      |..:.:|||.||:||    ..:|.|. ...|.:.|     .|.|:...:
Human   389 KIQKKEEKAE------PPQAMNALMRLNQLK----PGLQYKLVSQTGPVHAPIFTMSVEVDGNSF 443

  Fly   159 EAEGSSVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDD 223
            ||.|.|..:|:.....|.||:     |.......|:.....||...|..|..|:.......:...
Human   444 EASGPSKKTAKLHVAVKVLQD-----MGLPTGAEGRDSSKGEDSAEETEAKPAVVAPAPVVEAVS 503

  Fly   224 IDVATLYNDLKNKQTSVVEPKKP-LPETWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSV 287
            ...|...:|...:.   |:.:.| |.:..||  |.|.||..|....:.:...||.:.:..|.|.|
Human   504 TPSAAFPSDATAEN---VKQQGPILTKHGKN--PVMELNEKRRGLKYELISETGGSHDKRFVMEV 563

  Fly   288 CVDNCEFNAEGPSKKAARYKLSALVCNKLF 317
            .||..:|...|.:||.|:...:.....|||
Human   564 EVDGQKFQGAGSNKKVAKAYAALAALEKLF 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
ILF3NP_001381737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..86
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..401 11/54 (20%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 371..389 4/23 (17%)
Interaction with PRMT1. /evidence=ECO:0000269|PubMed:10749851 613..898
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 629..664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 722..898
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.