DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: blanks and Adad1

Sequence 1:NP_647966.1 Gene:blanks FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006232340.1 Gene:Adad1 RGDID:1359309 Length:636 Species:Rattus norvegicus

Alignment Length:337 Identity:67/338 (20%)
Similarity:119/338 (35%) Gaps:108/338 (32%)


  Fly    20 KKALIPNPSAEEDAVAVIPLADNLKKTAMGGENKSDEKG---TVSSEPKALSDQITSSMRVTKNK 81
            ::|.:|.|...      :|||.:| ..::|||...|..|   |..:.....|.::.|..::.|..
  Rat     8 RRAPVPGPRLG------LPLAAHL-PASLGGEGAKDSLGGEKTSGNNDWFQSSRVPSFAQMLKKN 65

  Fly    82 IADDKSSDVITDDATNGRKKQK---KNKKAKIRPLT----MPVTSKDALMVLNE-LKGVTVDNMQ 138
            :....|:..:|  ...|...:.   .|..:|:..:|    .|:.||....:.|. |....:....
  Rat    66 LPVQSSAQTVT--LPTGYSSESCSLSNMASKVTQVTGNFPEPLLSKGLSSISNPVLPPKKIPKEF 128

  Fly   139 IKRDHEGKI-----------MARV----------------------VVNSKKYEAE-GSSVNSAR 169
            |.:...|:|           |.||                      ||:..:|:.. |.:...:|
  Rat   129 IMKYRRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYKTGLGQNKKESR 193

  Fly   170 NAACEKALQEILTTKMKAVLDGP-GKSLES------DEDDILEKMASYAIHKLGEEWKTDDIDVA 227
            :.|.:.||.|:|.      ||.| .::||.      ..:.|:...|:| |.|:..|         
  Rat   194 SNAAKLALDELLQ------LDEPEPRALEPAGPPPIPAEPIVTPEAAY-ISKVQYE--------- 242

  Fly   228 TLYNDLKNKQTSVVEPKKPLPETWKNM---HPCMVLNYMRPQCT-----FIVSGG-------TGT 277
                   .:|....:..:.:.||:..:   |.    .|::  |:     ||:..|       .||
  Rat   243 -------GRQVQYAKISQLVKETFSQLISSHS----QYLK--CSSSLAAFIIERGGHHEVVAIGT 294

  Fly   278 NQNNTFSMSVCV 289
            .:   ::.|.|:
  Rat   295 GE---YNYSQCI 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Adad1XP_006232340.1 DSRM 139..204 CDD:214634 12/65 (18%)
A_deamin 291..611 CDD:280326 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121214523
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10910
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.