DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: blanks and Strbp

Sequence 1:NP_647966.1 Gene:blanks FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011237345.1 Gene:Strbp MGIID:104626 Length:678 Species:Mus musculus

Alignment Length:279 Identity:69/280 (25%)
Similarity:103/280 (37%) Gaps:63/280 (23%)


  Fly    54 SDEKGTVSSEPKALSDQITSSMRVTKNKIADDKSSDVITDDATNGRKKQKKNKKAKIRPL--TMP 116
            :|::|..||..|          |..::.:.|||..:          ||.|:|    :|.:  :..
Mouse   345 TDKEGAGSSALK----------RPFEDGLGDDKDPN----------KKMKRN----LRKILDSKA 385

  Fly   117 VTSKDALMVLNELKGVTVDNMQIK-RDHEGKIMARVV-----VNSKKYEAEGSSVNSARNAACEK 175
            :...:|||.||:::    ..:|.| ....|.:.|.|.     |:...|||.|.|..:|:.....|
Mouse   386 IDLMNALMRLNQIR----PGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVK 446

  Fly   176 ALQEILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSV 240
            .||.:   ......|...:.:.|||             |...|.|.|.:.    .|...|...|.
Mouse   447 VLQAM---GYPTGFDADIECISSDE-------------KSDNESKNDTVS----SNSSNNTGNST 491

  Fly   241 VEPKKPLPE-------TWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEG 298
            .|....|..       |....:|.|.||..|....:.:...||.:.:..|.|.|.||..:|...|
Mouse   492 TETSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFRGAG 556

  Fly   299 PSKKAARYKLSALVCNKLF 317
            |:||.|:...:.....|||
Mouse   557 PNKKVAKASAALAALEKLF 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
StrbpXP_011237345.1 DZF 81..334 CDD:128842
DSRM 389..452 CDD:214634 20/70 (29%)
DSRM 512..>558 CDD:214634 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120933301
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.