DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: blanks and Adarb2

Sequence 1:NP_647966.1 Gene:blanks FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_579836.1 Gene:Adarb2 RGDID:621519 Length:746 Species:Rattus norvegicus

Alignment Length:336 Identity:78/337 (23%)
Similarity:126/337 (37%) Gaps:54/337 (16%)


  Fly    28 SAEEDAVAVIP--LADNLKKTAMGGENKSDEKGTVSSEPKALSDQI-TSSMRVTKNKIADDKSSD 89
            |..:|.|:::.  ||. .|..:.|..|..||            |.: |||..|.:|:...:..:.
  Rat    30 SKRKDKVSILSTFLAP-FKYLSPGTTNTEDE------------DNLSTSSAEVKENRNVSNLGTR 81

  Fly    90 VIT--DDATNGRKKQKKNKK----------AKI----RPLTMPVTSKDALMVLNELKGVTVDNM- 137
            .:.  |.|..|.....|.|:          .|:    :.|:..:|.|:||:.|:|||......| 
  Rat    82 PLPPGDWARGGSTPSVKRKRPLEEGNGGHFCKLQLIWKKLSWSMTPKNALVQLHELKPGLQYRMV 146

  Fly   138 -QIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEKALQEIL--TTKMKAVL-----DGPGK 194
             |....|.......|.||...:|..|.:...|:..|.|.||:..:  ....:|.|     ..|..
  Rat   147 SQTGPVHAPVFAVAVEVNGLTFEGTGPTKKKAKMRAAEMALKSFVQFPNAFQAHLAMGSSTSPCT 211

  Fly   195 SLESDEDDILEKM-ASYAIHKLGEEW------KTDDIDVA-----TLYNDLKNKQTSVVEPKKPL 247
            ...||:.|..:.: ..:......|::      .|:.:..|     .||:.|.....::.:..:..
  Rat   212 DFTSDQADFPDTLFKEFEPSSRNEDFPGCCPVDTEFLSSAYRRGRLLYHTLDLMGQALPDRSRLA 276

  Fly   248 PETWKNMHPCMVLNYMRPQCTFIVSGGTGTNQN-NTFSMSVCVDNCEFNAEGPSKKAARYKLSAL 311
            |......:|.:|||.:|....::....|..... .:|.|:||||...|...|.|||.|:.:.:..
  Rat   277 PGALGERNPVVVLNELRSGLRYVCLSETAEKPRVKSFVMAVCVDGRTFEGSGRSKKLAKGQAAQA 341

  Fly   312 VCNKLFGTDYP 322
            ....||....|
  Rat   342 ALQALFDIRLP 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
blanksNP_647966.1 None
Adarb2NP_579836.1 R-domain (ssRNA-binding). {ECO:0000250} 23..35 2/5 (40%)
DSRM 126..190 CDD:238007 21/64 (33%)
DSRM 285..>332 CDD:214634 16/47 (34%)
ADEAMc 367..743 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121650041
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.