DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir64a and Ir85a

Sequence 1:NP_647962.1 Gene:Ir64a FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_649833.1 Gene:Ir85a FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster

Alignment Length:432 Identity:83/433 (19%)
Similarity:139/433 (32%) Gaps:152/433 (35%)


  Fly   141 EWLEGVLRMEALRQIA-------VVDLACGAV----SRRFLELASAKMLYSEKFHWLLIEDFAWH 194
            :||:.:|.:..|..:|       .:||...::    ..:.|..|..|:|:      :..|:...|
  Fly     4 QWLKHILLLAILVNLAGTRENHIPLDLKKSSIVMVKMSQILCKARIKVLF------VYFENQTSH 62

  Fly   195 GRT-QTAEGSGKRDDGEMEEEEPPGQQIQATDDEDLPSIESFLGGMNLYM---------NTELTL 249
            ..| |..:...|.|   :..:..|   ::|..|:          |:.:||         ..||:|
  Fly    63 EHTGQILKEVTKCD---ISNQNTP---LEAVKDD----------GILMYMVMITTNISQPLELSL 111

  Fly   250 AKRMSEAAHY-----------TLFDVW--------------NPGLNY--GGHVNLTEIGSF---- 283
            .::.|.|.|.           |:.|.|              |..:.|  .|.:|......|    
  Fly   112 IRKKSAAKHRSHVFLLVRDADTVSDAWMRASFRQFWKIWLLNIVILYWRDGRLNAYRYNPFMDNY 176

  Fly   284 ------TPTEGIQLHTWF-RTTSTVRR---RMDMQHARVRC--------------MVVVTNKNMT 324
                  .|.|...|...| :|...::|   ||.:....||.              :.....:.:.
  Fly   177 LIPVDNKPNEVPTLEQLFPKTIPNMQRKPLRMCIYKDDVRAIFWRQGTILGTDGLLAAYVAERLN 241

  Fly   325 GTLMYYLTHTMSGH--------IDTMNRFNFNLLMAVRDMFNWTFVLSRTTSWGYVKNGRFDGMI 381
            .|:|....|:.:.|        ::....: .::.|.:|.:...||   |..:...|.:.| |.:.
  Fly   242 ATMMITRPHSYNNHNLSSDICFLEVAKEY-VDVAMNIRFLVPDTF---RKQAESTVSHTR-DDLC 301

  Fly   382 GALIRNETDIGGAPIFYWLERHKWIDVAGRSWSSRPCFIFRHPRSTQKDRIVFLQPFTNDVWILI 446
            ..:.:.:|    ||.|               |:     |||              .|.:.||.||
  Fly   302 VIVPKAKT----APTF---------------WN-----IFR--------------SFGSLVWALI 328

  Fly   447 VGCGVLTVFILWFLTTIEWKLVPHD--GSALIKPKGGAPPRH 486
            : ..||...:..::...|...||..  ..||..|....||.|
  Fly   329 L-VSVLVANVFCYILKSEVGRVPMQLFAGALTMPMTQIPPNH 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 24/114 (21%)
Lig_chan 563..828 CDD:278489
Ir85aNP_649833.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114037226
eggNOG 1 0.900 E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.