DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir64a and Ir8a

Sequence 1:NP_647962.1 Gene:Ir64a FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_727328.1 Gene:Ir8a FlyBaseID:FBgn0052704 Length:936 Species:Drosophila melanogaster

Alignment Length:763 Identity:146/764 (19%)
Similarity:252/764 (33%) Gaps:224/764 (29%)


  Fly   153 RQIAVVDLACGA-----------VSRRFLELASAKMLYSEKFHWLLIEDFAWHGRTQTAEGSGKR 206
            |.:.:.||.||:           |.|..:..|..    |..:...:.:|.     ..||..|...
  Fly   247 RSMPMPDLYCGSGFTMQRAMLLNVLRSLINAAQV----SPGYPLAIYQDC-----NATASSSEVS 302

  Fly   207 DDGEMEEEE--------------PPGQQIQATDDEDLPSIESFLGGMNLYMNTELTLAKRMSEAA 257
            |..|.::..              ||...||......:|.               ||.|..:| |.
  Fly   303 DPLEKDDYNWLDMVHWSNFLAYAPPLPHIQDQFQSPVPG---------------LTFAVNIS-AG 351

  Fly   258 HYTLFDVWNPGLNYGGHVNLTEIGSFTPTEGIQLHTWFRTTSTVRRRMDMQHARVRCMVVVTNKN 322
            :|:           ..|...|::.:::....::|..  .|.|..||...:..|.......:..:.
  Fly   352 YYS-----------SEHEAKTDLAAWSSVGEMRLLN--ETISPARRFFRIGTAESIPWSYLRREE 403

  Fly   323 MTGTLMYYLTHTMSGHIDTMNRFNFNLLMAVRDMFNWTF--VLSRTTSWGYVKN-GRFDGMIGAL 384
            .||.|:    ...|| :.....:..:.::.:....|:.|  |.......|.:.. |.:||::|.|
  Fly   404 GTGELI----RDRSG-LPIWEGYCIDFIIRLSQKLNFEFEIVAPEVGHMGELNELGEWDGVVGDL 463

  Fly   385 IRNETDIGGAPIFYWLERHKWIDVAGRSWSSRPCFI-FRHP-RSTQKDRIVFLQPFTNDVWILIV 447
            :|.|||...|.:..:.||.:.||.....:......| .|.| |.|...:  |:.....:||:.||
  Fly   464 VRGETDFAIAALKMYSEREEVIDFLPPYYEQTGISIAIRKPVRRTSLFK--FMTVLRLEVWLSIV 526

  Fly   448 GCGVLTVFILWFLTTIEWKLVPHDGSALIKPKGGAPPRHHYQQQQQQEQVEAPVRPITAVSVVVS 512
            ...|.|..::||:.    |..|                  |..:..::......|..|       
  Fly   527 AALVGTAIMIWFMD----KYSP------------------YSSRNNRQAYPYACREFT------- 562

  Fly   513 KEKVEEKQEEYEDSTPIDAGTLWQRCYQKLNKYIKDRKAKQKKAPERVGLFLESVLFFVGIICQQ 577
                                                              ..||..|.:.....|
  Fly   563 --------------------------------------------------LRESFWFALTSFTPQ 577

  Fly   578 GLGFSTSFVSGRCIVITSLLFSFCIYQFYSASIVGTLLMEKPKT-IKTLSDLVHSS------LK- 634
            |.|.:...:|||.:|....||...:...::|::...|.:|:.:| :::|..|...|      :| 
  Fly   578 GGGEAPKAISGRMLVAAYWLFVVLMLATFTANLAAFLTVERMQTPVQSLEQLARQSRINYTVVKD 642

  Fly   635 -------VGM---EDILYN--RDYFLH-TKDPVSMELYAKKITSVPTTKENEADEDEPVDPNPVS 686
                   |.|   ||.||.  ::..|: :||.....::                 |.|:      
  Fly   643 SDTHQYFVNMKFAEDTLYRMWKELALNASKDFKKFRIW-----------------DYPI------ 684

  Fly   687 TDPAKSYRDI---VHSHETGAHAKDNAASNWLDPETGLLRHLGFAF-HVDVAAAYKIIAETFSEQ 747
               .:.|..|   ::|.:..|.||:..|:  :|..    .:..:|| |......|:|...     
  Fly   685 ---KEQYGHILLAINSSQPVADAKEGFAN--VDAH----ENADYAFIHDSAEIKYEITRN----- 735

  Fly   748 DICDLTEV-SMFPPQKTVSIMQKNSPMRKVISYGLRRVTETGIL-TYHFNVWH-SRKPPCVKKIE 809
              |:|||| .:|..|.....:|:.|.:...:||.:..:.:.... ......|: |..|.|  .:.
  Fly   736 --CNLTEVGEVFAEQPYAVAVQQGSHLGDELSYAILELQKDRFFEELKAKYWNQSNLPNC--PLS 796

  Fly   810 TSDLHVDMDTVSSALLILLFSYAITLMILGTEIL-YSKWHNRIQLKWV 856
            .....:.::::....:..||...:.:|.||.|:| |.|..|.:::..|
  Fly   797 EDQEGITLESLGGVFIATLFGLVLAMMTLGMEVLYYKKKQNALEITQV 844

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 32/119 (27%)
Lig_chan 563..828 CDD:278489 59/293 (20%)
Ir8aNP_727328.1 PBP2_iGluR_putative 383..786 CDD:270435 101/528 (19%)
Lig_chan 520..818 CDD:278489 74/418 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18966
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.