DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir64a and T25E4.2

Sequence 1:NP_647962.1 Gene:Ir64a FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_495081.2 Gene:T25E4.2 WormBaseID:WBGene00020804 Length:471 Species:Caenorhabditis elegans

Alignment Length:156 Identity:33/157 (21%)
Similarity:57/157 (36%) Gaps:45/157 (29%)


  Fly   717 PETGL-LRHLGFAFHVDVAAAYKIIAETFSEQDI-------CDLTEVSMFPPQKTVSIMQK---N 770
            |:.|. :..|...|.:..:.|..:..:...||.|       .|:|.||   .::|:..|:|   .
 Worm    32 PKPGAEVEFLNMTFQLMNSTATIVQIDADIEQSIDMVSNGSADITLVS---ARQTLDRMKKVDFT 93

  Fly   771 SPMRKV-ISYGLRRVTETGILTYHFNVWHSRKPPCVKKIETSDLHVDMDTVSSALLILLFSYAIT 834
            :|:..| ..|.:|.:.|..:..|...::                  |.||     |.:|.|:.  
 Worm    94 TPIGFVYYGYLVREIPELAVADYIMRLF------------------DYDT-----LAILISFG-- 133

  Fly   835 LMILGTEILYSKW----HNRIQLKWV 856
             :|:|..:....|    ..|..|.|:
 Worm   134 -LIIGALLYLYTWIFGLRVRSLLDWM 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360
Lig_chan 563..828 CDD:278489 25/123 (20%)
T25E4.2NP_495081.2 Periplasmic_Binding_Protein_Type_2 <65..>106 CDD:304360 11/44 (25%)
Periplasmic_Binding_Protein_Type_2 <297..351 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.