DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and Ubc84D

DIOPT Version :10

Sequence 1:NP_647959.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:83 Identity:22/83 - (26%)
Similarity:43/83 - (51%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFITKV---NIN-----C- 92
            :|:.|: :|..|.|::: |.:.|:....:.::|....:||..||.:.|.||:   |::     | 
  Fly    25 IESSDE-SLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCL 87

  Fly    93 --INQNNGVVDHRSVQML 108
              |:.:|.....|:.|:|
  Fly    88 PIISTDNWKPTTRTEQVL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_647959.1 UEV_UBE2V 9..142 CDD:467427 22/83 (27%)
Ubc84DNP_524260.1 UBCc_UBE2L3 3..149 CDD:467421 22/83 (27%)

Return to query results.
Submit another query.