DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and Ubc6

DIOPT Version :10

Sequence 1:NP_647959.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:118 Identity:37/118 - (31%)
Similarity:64/118 - (54%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPD 77
            |:|:.|:|  ....||.      |...|:::.:  |..:|.||..||||:..:.|.||..|.||:
  Fly    11 RDFKRLQE--DPPTGVS------GAPTDNNIMI--WNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65

  Fly    78 EPPTLRFITKVNINCINQNNGVVDHRSVQMLA-RWSREYNIKTMLQEIRRIMT 129
            :|||:||::||....:..:.|:    .:.:|. |||..|::..:|..|:.:::
  Fly    66 KPPTVRFVSKVFHPNVYADGGI----CLDILQNRWSPTYDVSAILTSIQSLLS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_647959.1 UEV_UBE2V 9..142 CDD:467427 37/118 (31%)
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 37/118 (31%)

Return to query results.
Submit another query.