DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and Kua

DIOPT Version :10

Sequence 1:NP_647959.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_610026.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster


Alignment Length:45 Identity:8/45 - (17%)
Similarity:19/45 - (42%) Gaps:7/45 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STGVVVPRNFRLLEELDQGQK--GVGDGTISWGLENDDDMTLTYW 48
            |..:::||....:..:...:.  .:..|.::|.||.     :.:|
  Fly   244 SCHIILPRKHHRIHHVAPHETYFCITTGWLNWPLER-----IRFW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_647959.1 UEV_UBE2V 9..142 CDD:467427 7/42 (17%)
KuaNP_610026.1 Lipid_desat 124..301 CDD:463132 8/45 (18%)

Return to query results.
Submit another query.