DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and CG2574

DIOPT Version :10

Sequence 1:NP_647959.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:124 Identity:33/124 - (26%)
Similarity:54/124 - (43%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TGVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIEC 71
            ||.||    |:..||...:|.......: .|.:.|   |.:|...:.||..:.:|...:.|.|..
  Fly    61 TGCVV----RIKSELQDIRKNPPPNCTA-DLHHGD---LLHWTAGVNGPVGSVYEGGHFRLDIRF 117

  Fly    72 GERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLA-RWSREYNIKTMLQEIRRIMT 129
            ...||...|.:||.|:: .:|...:.|.:   .:.:|. |||...|:..:|..|..:|:
  Fly   118 PASYPFRAPRIRFTTRI-YHCNVDSRGAI---CLDVLGERWSPVMNVAKVLLSIYVLMS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_647959.1 UEV_UBE2V 9..142 CDD:467427 31/122 (25%)
CG2574NP_572796.1 UBCc_UEV 66..204 CDD:483950 29/115 (25%)

Return to query results.
Submit another query.