DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and otu1

DIOPT Version :8

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_594039.1 Gene:otu1 / 2542649 PomBaseID:SPAC24C9.14 Length:329 Species:Schizosaccharomyces pombe

Alignment Length:362 Identity:100/363 (28%)
Similarity:172/363 (47%) Gaps:57/363 (16%)


  Fly     6 SVKLKSK-KGQFIVNDLNEHTTLGELKTKIVQATDIEATQLHVLVGYPPKPLDLSQQQEQRALKA 69
            |::|:.| :.|..|..:..:.|:|.....:.....:....:.:..|:||:.:.|.......:.. 
pombe     3 SLRLRLKYENQSAVETVEANATVGSFLDLVAAKFSLPRNSIALKFGFPPQDIPLVNSDVPLSTL- 66

  Fly    70 VGINSGETLIVEEKAAPA-----PAAP----------VPGGTTVEDDEALARRLQAEEEAQLLQE 119
              ::||:.::|.:.||.:     ||.|          .|..|.:.:..|::.:         .:.
pombe    67 --VSSGQQILVLKNAATSFSTNEPAKPPIPNAATKPTFPPQTEISNPPAVSHQ---------SKN 120

  Fly   120 TAGGPVAQAADYQLPVAPTESGPNGDFNGILLKKVVPADNSCLFTSIRFVLNGKVDNEGSEMMRH 184
            |:..|            |..|.|.||    :..:|:|.||||||.::...| |....|    :|.
pombe   121 TSQDP------------PYVSTPIGD----IALRVMPDDNSCLFRALSKPL-GFSPYE----LRE 164

  Fly   185 IIAQEVAADPQSYNDAVLGKSNAEYCAWIQKADSWGGAIEVSILSNYYGIEIDVVDIQNAIINRF 249
            |:|.:|.::|..|:.|:|||.:.||.:||:|..||||.||:||||:::|:||..||::...::.:
pombe   165 IVANQVLSNPDIYSTAILGKPSIEYASWIRKETSWGGYIELSILSSHFGVEICSVDVKTGRVDSY 229

  Fly   250 GEDKNFGLRVFLLFDGIHYD-----PLYMETSPSAAPATIFPVEELGVYQQAEQLANEAQSSRQY 309
            ......|.|.::::.|||||     .:..:|.   ....:|...::.:....:|||:..::...|
pombe   230 NPQPATGQRTYIVYSGIHYDLAALAAVLWDTD---VDVVLFDASDVTITPYVQQLASLLKNMHYY 291

  Fly   310 TNVDKFTLRCMQCDVRLVGQVQAQEHAKQTGHKNFGE 346
            |:...|::||..|...|||:..|..||..|||..|||
pombe   292 TDTASFSIRCTICGTGLVGEKDATAHALATGHTQFGE 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563 13/75 (17%)
UBQ 10..80 CDD:294102 11/71 (15%)
COG5539 <158..346 CDD:227826 68/193 (35%)
otu1NP_594039.1 COG5539 7..329 CDD:227826 98/359 (27%)
OTU 141..249 CDD:303090 46/113 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H13176
Inparanoid 1 1.050 143 1.000 Inparanoid score I1331
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005135
OrthoInspector 1 1.000 T1125591
orthoMCL 1 0.900 OOG5_129000
Panther 1 1.100 LDO PTHR13312
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R880
TreeFam 1 0.960
109.950

Return to query results.
Submit another query.