DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and BUD32

DIOPT Version :8

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_011778.1 Gene:BUD32 / 853178 SGDID:S000003494 Length:261 Species:Saccharomyces cerevisiae

Alignment Length:244 Identity:82/245 (33%)
Similarity:121/245 (49%) Gaps:29/245 (12%)


  Fly     6 LKQGAEGRL-------YLGDFKG--EACLIKERFVKKYRHPELNTQITRQRMKAEAKASGRC-LA 60
            :.||||..:       ||...|.  :..:||.|..|:||||:::..:|:.|...|::...:. |.
Yeast    22 ISQGAEAIVFTTTTHPYLPRAKDSHQKYIIKYRPPKRYRHPQIDQALTKHRTLNESRLLAKLYLI 86

  Fly    61 AGILAPKILHSDLNTHKLYMEYF-------DAAKTAKQFIQETVSTQTEDEAKKCLLEFCTRIGE 118
            .|:..|:::..|.....:::|:.       ......|.|:.    ...:|.....:.....::|.
Yeast    87 PGLCVPQLIACDPYNGFIWLEFLGEDLPGGHGFSNLKNFLW----MHDQDPYSDLVATTLRKVGR 147

  Fly   119 IIGKMHSNHIIHGDLTTSNILINPKGGDYDVILIDFGLSHYNQATEDKGVDLYVLERALLSTHSE 183
            .||.:|.|...|||||:|||::...|..:...||||||...:...|||||||||||||:|||||:
Yeast   148 QIGLLHWNDYCHGDLTSSNIVLVRDGARWTPHLIDFGLGSVSNLVEDKGVDLYVLERAILSTHSK 212

  Fly   184 -----QPYIFEHVLAAYRTACGKDE---QAVLTKFEEVRARGRKRTMIG 224
                 ..:|.|.....||....|..   :.|..:|||||.|||||:|:|
Yeast   213 HAEKYNAWIMEGFEEVYREQGAKGAKKLKEVTKRFEEVRLRGRKRSMLG 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 81/243 (33%)
BUD32NP_011778.1 Bud32 19..261 CDD:226168 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160346529
eggNOG 1 0.900 E1_COG3642
Hieranoid 1 1.000
Homologene 1 1.000 H6042
Inparanoid 1 1.050 113 1.000 Inparanoid score I1330
Isobase 1 0.950 0 Normalized mean entropy S1720
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002796
OrthoInspector 1 1.000 T1136622
orthoMCL 1 0.900 OOG5_127673
Panther 1 1.100 LDO PTHR12209
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R156
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.