DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and Trp53rkb

DIOPT Version :8

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006500434.1 Gene:Trp53rkb / 76367 MGIID:1914050 Length:268 Species:Mus musculus

Alignment Length:222 Identity:102/223 (46%)
Similarity:141/223 (63%) Gaps:4/223 (2%)


  Fly     3 LEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKAEAKASGRCLAAGILAPK 67
            ||:::||||.|::.|.|:|.|.::|.||.|.||||||..::.|:|...||:|..||..|||.||.
Mouse    51 LELVQQGAEARVFRGRFQGRAAVVKHRFPKSYRHPELEARLGRRRTVQEARALLRCRRAGIAAPV 115

  Fly    68 ILHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQTEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGD 132
            :...|..::.||||..:.:.|.:.:||.|:.|:.:.:   |||:...|:|:::..||...:||||
Mouse   116 VFFVDYASNCLYMEEIEDSVTVRDYIQSTMETEKDPQ---CLLDLARRMGQVLAGMHDQDLIHGD 177

  Fly   133 LTTSNILINPKGGDYDVILIDFGLSHYNQATEDKGVDLYVLERALLSTHSEQPYIFEHVLAAYRT 197
            |||||:|:........::|||||||..:...|||||||||||:|.||||......||..|.:| .
Mouse   178 LTTSNMLLRRPLAQLHIVLIDFGLSFVSGLPEDKGVDLYVLEKAFLSTHPHTETAFEAFLKSY-G 241

  Fly   198 ACGKDEQAVLTKFEEVRARGRKRTMIG 224
            |..|....||.|.:|||.|||||:|:|
Mouse   242 ASSKKSSPVLKKLDEVRLRGRKRSMVG 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 101/221 (46%)
Trp53rkbXP_006500434.1 Bud32 51..268 CDD:226168 101/221 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160341309
eggNOG 1 0.900 E1_COG3642
Hieranoid 1 1.000
Homologene 1 1.000 H6042
Inparanoid 1 1.050 196 1.000 Inparanoid score I3784
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1425238at2759
OrthoFinder 1 1.000 FOG0002796
OrthoInspector 1 1.000 T616829
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12209
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R156
TreeFam 1 0.960
1312.900

Return to query results.
Submit another query.