DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and tp53rk

DIOPT Version :8

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001018386.2 Gene:tp53rk / 553571 ZFINID:ZDB-GENE-050522-123 Length:231 Species:Danio rerio

Alignment Length:224 Identity:98/225 (44%)
Similarity:145/225 (64%) Gaps:14/225 (6%)


  Fly     4 EILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKAEAKASGRCLAAGILAPKI 68
            :::|||||.|:|...|.|.:.:|||||.|.|||||::.::||:|...|.::..||..|||.||.:
Zfish    19 QMIKQGAEARVYRSTFLGRSVIIKERFPKLYRHPEVDEKLTRRRTTQEVRSILRCRRAGISAPVV 83

  Fly    69 LHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQTEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGDL 133
            ...|..||.::::  |...:..  :::.:.:|.:.     |.....||||::.:||...:|||||
Zfish    84 YFVDYATHCIFLQ--DVVNSVS--VRDHIRSQPDG-----LQTLAERIGEVLAQMHDEDVIHGDL 139

  Fly   134 TTSNILINPKGG---DYDVILIDFGLSHYNQATEDKGVDLYVLERALLSTHSEQPYIFEHVLAAY 195
            ||||:|:. .||   |::::|||||||:.:...|||||||||||:|.||||.:...:||.:|.:|
Zfish   140 TTSNMLLT-SGGQQQDFNLVLIDFGLSYISALPEDKGVDLYVLEKAFLSTHPKTEALFERLLKSY 203

  Fly   196 RTACGKDEQAVLTKFEEVRARGRKRTMIG 224
            .:| .|...||:.|.:|||.|||||:|:|
Zfish   204 SSA-SKKSTAVIKKLDEVRLRGRKRSMVG 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 97/223 (43%)
tp53rkNP_001018386.2 Bud32 21..231 CDD:226168 97/221 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160341433
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H6042
Inparanoid 1 1.050 181 1.000 Inparanoid score I3912
OMA 1 1.010
OrthoDB 1 1.010 D1425238at2759
OrthoFinder 1 1.000 FOG0002796
OrthoInspector 1 1.000 T1053988
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12209
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R156
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.040

Return to query results.
Submit another query.