DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and Tp53rk

DIOPT Version :8

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001102076.1 Gene:Tp53rk / 362272 RGDID:1304911 Length:244 Species:Rattus norvegicus

Alignment Length:222 Identity:101/223 (45%)
Similarity:143/223 (64%) Gaps:4/223 (2%)


  Fly     3 LEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKAEAKASGRCLAAGILAPK 67
            ||:::||||.|::.|.|:|.|.::|.||.|.||||||..::.|:|...||:|..||..|||.||.
  Rat    27 LELVQQGAEARVFRGRFQGRAAVVKHRFPKGYRHPELEARLGRRRTVQEARALLRCRRAGIAAPV 91

  Fly    68 ILHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQTEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGD 132
            :...|..::.||||..:.:.|.:.:||.|:.|:.:.:   |||:...:||:::.::|...:||||
  Rat    92 VFFVDYASNCLYMEEIEDSVTVRDYIQSTMETKQDPQ---CLLDLARKIGQVLARLHDEDLIHGD 153

  Fly   133 LTTSNILINPKGGDYDVILIDFGLSHYNQATEDKGVDLYVLERALLSTHSEQPYIFEHVLAAYRT 197
            |||||:|:........::|||||||..:...|||||||||||:|.||||.....:||..|.:| .
  Rat   154 LTTSNMLLTRPLEQLHIVLIDFGLSFVSGLPEDKGVDLYVLEKAFLSTHPHTETVFEAFLKSY-G 217

  Fly   198 ACGKDEQAVLTKFEEVRARGRKRTMIG 224
            |..|....||.|.:|||.|||||:|:|
  Rat   218 ASSKKSDPVLKKLDEVRLRGRKRSMVG 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 100/221 (45%)
Tp53rkNP_001102076.1 Bud32 27..244 CDD:226168 100/221 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160341994
eggNOG 1 0.900 E1_COG3642
Hieranoid 1 1.000
Homologene 1 1.000 H6042
Inparanoid 1 1.050 196 1.000 Inparanoid score I3676
OMA 1 1.010
OrthoDB 1 1.010 D1425238at2759
OrthoFinder 1 1.000 FOG0002796
OrthoInspector 1 1.000 T618944
orthoMCL 1 0.900 OOG5_127673
Panther 1 1.100 LDO PTHR12209
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.