DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and RAD27

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_012809.1 Gene:RAD27 SGDID:S000001596 Length:382 Species:Saccharomyces cerevisiae

Alignment Length:522 Identity:110/523 (21%)
Similarity:183/523 (35%) Gaps:173/523 (33%)


  Fly     1 MGVKELWGVLTPH----CERKPINELRGKKVAIDLAGWVCESLNVVDYFVHPRH----------- 50
            ||:|.|..:::.|    ..:..|....|:|||||      .|:::..:.:..|.           
Yeast     1 MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAID------ASMSLYQFLIAVRQQDGGQLTNEAG 59

  Fly    51 ----HLKNLFFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSK 111
                ||..:|:||..:|...:.|.:|.:|..|.|||..:.||:..:....| |.:...|:.:..|
Yeast    60 ETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEK-KLAEATTELEKMK 123

  Fly   112 GDKGRSRFNHVLK----QCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGA 172
            .::   |...|.|    :.:.||..|||..:..|.||||.||.|.|.|.|....|:|.|...|..
Yeast   124 QER---RLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYRT 185

  Fly   173 VRVYRNFSVSTQGAQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDGV 237
            ..:.|:.:.|     .|....:...|...:...:|...::.:.:.::.||||| :.|.|:|....
Yeast   186 PFLLRHLTFS-----EAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYC-ESIRGVGPVTA 244

  Fly   238 LKLFNKYKETEILDRMRSWRGETDKYNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVCRTHKGC 302
            |||...:                                   |.|.|.....:||.|        
Yeast   245 LKLIKTH-----------------------------------GSIEKIVEFIESGES-------- 266

  Fly   303 DESLWKEQRLSIKSELTLRRKALLSPDFPNEEIIAEFLSEPDTIP--NLNLNWRQPNLVKFIKQI 365
            :.:.||                 :..|:|.::....|| :|:.|.  .:||.|..|...:.|   
Yeast   267 NNTKWK-----------------IPEDWPYKQARMLFL-DPEVIDGNEINLKWSPPKEKELI--- 310

  Fly   366 GHLLQWPEIYCFQKFFPILTRWQVQQSKQEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIFKGL 430
                   |..|..|.|.                       ::|...|:..|:      .|:..|:
Yeast   311 -------EYLCDDKKFS-----------------------EERVKSGISRLK------KGLKSGI 339

  Fly   431 IPDKQIAEYEAEHPKGIEELYYTIEPLDMLETAYPDLVAAFLKSKEK--PAKKTTRKKKTASEEE 493
                          :|..:.::.:.|                |:||:  .|.|..::.|..::.:
Yeast   340 --------------QGRLDGFFQVVP----------------KTKEQLAAAAKRAQENKKLNKNK 374

  Fly   494 NK 495
            ||
Yeast   375 NK 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 95/409 (23%)
H3TH_GEN1 210..342 CDD:188625 23/132 (17%)
RAD27NP_012809.1 XPG_I 1..364 CDD:331126 107/509 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.