DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gen and DIN7

Sequence 1:NP_647943.2 Gene:Gen FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_010549.3 Gene:DIN7 SGDID:S000002671 Length:430 Species:Saccharomyces cerevisiae

Alignment Length:559 Identity:102/560 (18%)
Similarity:183/560 (33%) Gaps:206/560 (37%)


  Fly     1 MGVKELWGVLTPHCERKPINELRGKKVAIDLAGWV------CESLNVVDYFVHPRHHLKNLFFRT 59
            ||:..|...|....::..:.:...:.:|||...|:      |....|::   .|.:.....|.:.
Yeast     1 MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMN---KPTNKYLQFFIKR 62

  Fly    60 CYLIWE-QVTPVFVLEGVA-------------PKLKSQVIAKR--------NELQFRGVKPKNSP 102
            ..|:.. ::.|..|.:|.:             .:|::::|||:        |.:::.......:|
Yeast    63 LQLLKRLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYFQKSVDITP 127

  Fly   103 ECTQSQPSKGDKGRSRFNHVLKQCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDC 167
            |..:.              ::..|:.    ..|..:..|.||:....:|.|.||:.|:||:|||.
Yeast   128 EMAKC--------------IIDYCKL----HSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDL 174

  Fly   168 FAYGAVRVYRNFSVSTQGAQAAAGGAVDIYDMREITSRMDF------------GQQKIIVMALLC 220
            ..:|...:....:        ..|.|::|       |:.||            .:|:...:..|.
Yeast   175 LVFGCKTLITKLN--------DQGKALEI-------SKDDFSALPENFPLGELSEQQFRNLVCLA 224

  Fly   221 GCDYCPDGIGGIGKDGVLKLFNKYKE-TEILDRMRSWRGETDKYNALEIRVDDKSICSNCGHIGK 284
            |||| ..||..:|....:|:..:|.| .:||                 |:::             
Yeast   225 GCDY-TSGIWKVGVVTAMKIVKRYSEMKDIL-----------------IQIE------------- 258

  Fly   285 TQSHTKSGCSVCRTHKGCDESLWKEQRLSIKSELTLRRKALLSPDFPNEEIIAEFLSEPDTIPNL 349
                        ||.|.|....:|:|                          .||.:        
Yeast   259 ------------RTEKLCFSKAFKQQ--------------------------VEFAN-------- 277

  Fly   350 NLNWRQPNLVKFIKQIGHLLQWPEIYCFQKFFPILTRWQVQQSKQEKILIQPHEIIKKRTVKGVP 414
                             :..|:..::|     |:..:.....:..:.:.....||||  .:|.:.
Yeast   278 -----------------YAFQYQRVFC-----PLSNQITTLNNIPKAVTNSHAEIIK--IMKCIG 318

  Fly   415 SLELRWHDPSGIFKGLIPDKQIAEYEAEHPKGIEELYYTIEPLDM---LETAYPDLVA------- 469
            |:..|   .||:.|.:|..|.| :::........||:    |:||   |......|.|       
Yeast   319 SVVER---GSGVRKDVINTKNI-DHKVHEMIAKGELH----PVDMASKLINRERKLKARKLFKVG 375

  Fly   470 -------AFLKSKEKPAKKTTRKKKTASEEENKENEPNS 501
                   :|.|..|:|...|   :...||.||..:..|:
Yeast   376 LLGGESNSFNKKVEQPLVDT---QDVLSERENSLDNKNA 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 71/425 (17%)
H3TH_GEN1 210..342 CDD:188625 23/133 (17%)
DIN7NP_010549.3 PIN_EXO1 1..209 CDD:189027 45/244 (18%)
H3TH_StructSpec-5'-nucleases 215..287 CDD:328895 24/166 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.