DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gen and zgc:110269

DIOPT Version :9

Sequence 1:NP_647943.2 Gene:Gen / 38594 FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001017611.2 Gene:zgc:110269 / 550274 ZFINID:ZDB-GENE-050417-81 Length:350 Species:Danio rerio


Alignment Length:350 Identity:98/350 - (28%)
Similarity:152/350 - (43%) Gaps:72/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVKELWGVL---TPHCER-KPINELRGKKVAIDLAGWVCESLNVVDYF--VHPRH----HLKNL 55
            ||:.:|..::   .|...| |.|.:..||.:|:|.:       .||:.|  ..|.|    .|..|
Zfish     1 MGITKLAHLIHFDAPASMRSKEIGDYSGKIIALDTS-------IVVNQFRSALPGHLKLSPLAGL 58

  Fly    56 FFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQ-PSKGDKGRSRF 119
            |:||...:...:.|||||:|..|..|..|:.||.:          |...:.|| |:.|    |.|
Zfish    59 FYRTLAFLEHDIKPVFVLDGKPPHQKRAVLEKRAQ----------STGWSSSQSPNTG----SAF 109

  Fly   120 NHVLKQCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRVYRNFSVSTQ 184
            |   ::|..||..||:.|::.||||||.||.|.|.|.|:.|.|:|.|..|:|...:.|..:    
Zfish   110 N---QECLRLLHLMGVPCIKAPGEAEALCAHLAKIGTVNAVASEDMDTLAFGGTVLLRQLN---- 167

  Fly   185 GAQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDGVLKLFNKYKETE- 248
               |.....:..|.:.::...:....::.:.:.:|.||||| |.|||:|....|||..::...| 
Zfish   168 ---AKRDSEITEYSLPKLLEALQLKYEEFVDLCILLGCDYC-DKIGGLGPSRALKLIKEHHTIEG 228

  Fly   249 ILDRMR--------SWRGETDKYNALEI-RVDDKSIC-SNCGHIGKTQSHTKSGCSVCRTHKGCD 303
            :::.:.        :|:.:..:....|. ::||..:. |.....|..|..             |.
Zfish   229 VMEHVNRKTHPIPLNWQYKDARKLFFETPKIDDPVLAWSEPDEEGLVQFL-------------CK 280

  Fly   304 ESLWKEQRL-----SIKSELTLRRK 323
            |...||:|:     ..:..|..|||
Zfish   281 EKPLKEERVRGRMKKFREMLLKRRK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 97/349 (28%)
H3TH_GEN1 210..342 CDD:188625 30/129 (23%)
zgc:110269NP_001017611.2 PTZ00217 1..346 CDD:240317 97/349 (28%)
N-domain 1..95 32/110 (29%)
PIN_SF 2..325 CDD:301351 96/348 (28%)
I-domain 110..223 42/123 (34%)
H3TH_FEN1-Euk 191..255 CDD:188627 16/64 (25%)
Interaction with PCNA. /evidence=ECO:0000250 317..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.